Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Nuclear Factor Kappa B2 (NFkB2) Recombinant Protein | NFkB2 recombinant protein

Recombinant Nuclear Factor Kappa B2 (NFkB2)

Gene Names
Nfkb2; lyt; p49; p52; p50B; p49/p100; NF-kappaB2
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
Nuclear Factor Kappa B2 (NFkB2); Recombinant Nuclear Factor Kappa B2 (NFkB2); NFkB2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and T7-tag, its sequence is listed below.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-ADGPYL VIVEQPKQRG FRFRYGCEGP SHGGLPGASS EKGRKTYPTV KICNYEGPAK IEVDLVTHSD PPRAHAHSLV GKQCSELGVC AVSVGPKDMT AQFNNLGVLH VTKKNMMEIM IQKLQRQRLR SKPQGLTEAE RRELEQEAKE LKKVMDLSIV RLRFSAFLRA SDGSFSLPLK PVISQPIHDS KSPGA
Sequence Length
899
Applicable Applications for NFkB2 recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Mus musculus (Mouse)
Expression System
Prokaryotic expression
Residues
Ala35~Ala225 (Accession # Q9WTK5) with two N-terminal Tags, His-tag and T7-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

SDS-Page

SDS-Page

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.9kDa
NCBI Official Full Name
nuclear factor NF-kappa-B p100 subunit isoform a
NCBI Official Synonym Full Names
nuclear factor of kappa light polypeptide gene enhancer in B cells 2, p49/p100
NCBI Official Symbol
Nfkb2
NCBI Official Synonym Symbols
lyt; p49; p52; p50B; p49/p100; NF-kappaB2
NCBI Protein Information
nuclear factor NF-kappa-B p100 subunit; NF kappaB2; DNA-binding factor KBF2; nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, p49/p100
UniProt Protein Name
Nuclear factor NF-kappa-B p100 subunit
Protein Family
UniProt Gene Name
Nfkb2
UniProt Entry Name
NFKB2_MOUSE

Uniprot Description

NFkB-p100: a transcription factor of the nuclear factor-kappaB ( NFkB) group. Precursor of the p52 subunit of the nuclear factor NF-kappa-B, which binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. The precursor protein itself does not bind to DNA. LT-beta receptor agonists and LPS induce NF-kappaB/p100 processing to p52 at the level of the ribosome. There are five NFkB proteins in mammals (RelA/NFkB-p65, RelB, c-Rel, NF-_B1/NFkB-p105, and NF-_B2/NFkB-p100). They form a variety of homodimers and heterodimers, each of which activates its own characteristic set of genes. Two spliced isoforms have been identified. Isoform p49 is a subunit of the NF-kappa-B protein complex, which stimulates the HIV enhancer in synergy with p65.

Protein type: Oncoprotein; Transcription factor; DNA-binding

Cellular Component: Bcl3/NF-kappaB2 complex; nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; DNA binding; chromatin binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; spleen development; I-kappaB kinase/NF-kappaB cascade; extracellular matrix organization and biogenesis; transcription, DNA-dependent; follicular dendritic cell differentiation; cellular response to stress; rhythmic process; negative regulation of transcription from RNA polymerase II promoter; signal transduction; lymph node development; regulation of transcription, DNA-dependent; response to cytokine stimulus; germinal center formation; innate immune response; positive regulation of transcription from RNA polymerase II promoter; inflammatory response

Research Articles on NFkB2

Similar Products

Product Notes

The NFkB2 nfkb2 (Catalog #AAA2009649) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Nuclear Factor Kappa B2 (NFkB2) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the NFkB2 nfkb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and T7-tag, its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-ADG PYL VIVEQPKQRG FRFRYGCEGP SHGGLPGASS EKGRKTYPTV KICNYEGPAK IEVDLVTHSD PPRAHAHSLV GKQCSELGVC AVSVGPKDMT AQFNNLGVLH VTKKNMMEIM IQKLQRQRLR SKPQGLTEAE RRELEQEAKE LKKVMDLSIV RLRFSAFLRA SDGSFSLPLK PVISQPIHDS KSPGA. It is sometimes possible for the material contained within the vial of "Nuclear Factor Kappa B2 (NFkB2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.