Mouse anti-Human VRK1 Monoclonal Antibody | anti-VRK1 antibody

VRK1 (Vaccinia-related Kinase 1, Serine/threonine-protein Kinase VRK1, PCH1, PCH1A) (PE)

Cat. Num. AAA6161061

• Gene Names: VRK1; PCH1; PCH1A
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: VRK1; Monoclonal Antibody; VRK1 (Vaccinia-related Kinase 1; Serine/threonine-protein Kinase VRK1; PCH1; PCH1A) (PE); EC=2.7.11.1; anti-VRK1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4F9
• Specificity: Recognizes human VRK1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-VRK1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa287-396 from human VRK1 (NP_003375) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of VRK1 expression in transfected 293T cell line by VRK1 monoclonal antibody. Lane 1: VRK1 transfected lysate (45.5kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to VRK1 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of VRK1 transfected lysate using VRK1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with VRK1 monoclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged VRK1 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of VRK1 over-expressed 293 cell line, cotransfected with VRK1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with VRK1 monoclonal antibody (M02) GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-VRK1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4507903
• NCBI GeneID: 7443
• NCBI Accession #: NP_003375
• NCBI GenBank Nucleotide #: NM_003384
• UniProt Accession #: Q99986; Q3SYL2
• Molecular Weight: 45,476 Da
• NCBI Official Full Name: serine/threonine-protein kinase VRK1
• NCBI Official Synonym Full Names: vaccinia related kinase 1
• NCBI Official Symbol: VRK1
• NCBI Official Synonym Symbols: PCH1; PCH1A
• NCBI Protein Information: serine/threonine-protein kinase VRK1; vaccinia virus B1R-related kinase 1; vaccinia-related kinase 1
• UniProt Protein Name: Serine/threonine-protein kinase VRK1
• Protein Family: Serine/threonine-protein kinase
• UniProt Gene Name: VRK1

Uniprot Description

Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity.