Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of VRK1 expression in transfected 293T cell line by VRK1 monoclonal antibody. Lane 1: VRK1 transfected lysate (45.5kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human VRK1 Monoclonal Antibody | anti-VRK1 antibody

VRK1 (Vaccinia-related Kinase 1, Serine/threonine-protein Kinase VRK1, PCH1, PCH1A) (AP)

Gene Names
VRK1; PCH1; PCH1A
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
VRK1; Monoclonal Antibody; VRK1 (Vaccinia-related Kinase 1; Serine/threonine-protein Kinase VRK1; PCH1; PCH1A) (AP); EC=2.7.11.1; anti-VRK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F9
Specificity
Recognizes human VRK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-VRK1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa287-396 from human VRK1 (NP_003375) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of VRK1 expression in transfected 293T cell line by VRK1 monoclonal antibody. Lane 1: VRK1 transfected lysate (45.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of VRK1 expression in transfected 293T cell line by VRK1 monoclonal antibody. Lane 1: VRK1 transfected lysate (45.5kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to VRK1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to VRK1 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of VRK1 transfected lysate using VRK1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with VRK1 monoclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of VRK1 transfected lysate using VRK1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with VRK1 monoclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged VRK1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged VRK1 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of VRK1 over-expressed 293 cell line, cotransfected with VRK1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with VRK1 monoclonal antibody (M02) GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of VRK1 over-expressed 293 cell line, cotransfected with VRK1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with VRK1 monoclonal antibody (M02) GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-VRK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,476 Da
NCBI Official Full Name
serine/threonine-protein kinase VRK1
NCBI Official Synonym Full Names
vaccinia related kinase 1
NCBI Official Symbol
VRK1
NCBI Official Synonym Symbols
PCH1; PCH1A
NCBI Protein Information
serine/threonine-protein kinase VRK1; vaccinia virus B1R-related kinase 1; vaccinia-related kinase 1
UniProt Protein Name
Serine/threonine-protein kinase VRK1
UniProt Gene Name
VRK1

Uniprot Description

Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity.

Similar Products

Product Notes

The VRK1 vrk1 (Catalog #AAA6134546) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VRK1 (Vaccinia-related Kinase 1, Serine/threonine-protein Kinase VRK1, PCH1, PCH1A) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VRK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the VRK1 vrk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VRK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.