Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged LOXL2 is approximately 3ng/ml as a capture antibody.)

Mouse LOXL2 Monoclonal Antibody | anti-LOXL2 antibody

LOXL2 (Lysyl Oxidase-like 2, LOR2, WS9-14) (FITC)

Gene Names
LOXL2; LOR2; WS9-14
Applications
Western Blot
Purity
Purified
Synonyms
LOXL2; Monoclonal Antibody; LOXL2 (Lysyl Oxidase-like 2; LOR2; WS9-14) (FITC); Lysyl Oxidase-like 2; WS9-14; anti-LOXL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C5
Specificity
Recognizes LOXL2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-LOXL2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
LOXL2 (NP_002309, 675aa-773aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged LOXL2 is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LOXL2 is approximately 3ng/ml as a capture antibody.)
Related Product Information for anti-LOXL2 antibody
This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq]
Product Categories/Family for anti-LOXL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86,725 Da
NCBI Official Full Name
lysyl oxidase homolog 2
NCBI Official Synonym Full Names
lysyl oxidase-like 2
NCBI Official Symbol
LOXL2
NCBI Official Synonym Symbols
LOR2; WS9-14
NCBI Protein Information
lysyl oxidase homolog 2; lysyl oxidase related 2; lysyl oxidase-like 2 delta e13; lysyl oxidase-like 2 protein; lysyl oxidase-like protein 2; lysyl oxidase-related protein 2; lysyl oxidase-related protein WS9-14
UniProt Protein Name
Lysyl oxidase homolog 2
Protein Family
UniProt Gene Name
LOXL2
UniProt Entry Name
LOXL2_HUMAN

Uniprot Description

LOXL2: Mediates the post-translational oxidative deamination of lysine residues on target proteins leading to the formation of deaminated lysine (allysine). When secreted in extracellular matrix, promotes cross-linking of extracellular matrix proteins by mediating oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Acts as a regulator of sprouting angiogenesis, probably via collagen IV scaffolding. When nuclear, acts as a transcription corepressor and specifically mediates deamination of trimethylated 'Lys-4' of histone H3 (H3K4me3), a specific tag for epigenetic transcriptional activation. Involved in epithelial to mesenchymal transition (EMT) via interaction with SNAI1 and participates in repression of E- cadherin, probably by mediating deamination of histone H3. Also involved in E-cadherin repression following hypoxia, a hallmark of epithelial to mesenchymal transition believed to amplify tumor aggressiveness, suggesting that it may play a role in tumor progression. Acts as a regulator of chondrocyte differentiation, probably by regulating expression of factors that control chondrocyte differentiation. Belongs to the lysyl oxidase family.

Protein type: Secreted, signal peptide; Secreted; Cell adhesion; Oxidoreductase; EC 1.4.3.13

Chromosomal Location of Human Ortholog: 8p21.3

Cellular Component: basement membrane; chromosome; extracellular space; membrane; nucleoplasm; nucleus

Molecular Function: chromatin binding; copper ion binding; electron carrier activity; methylated histone residue binding; protein binding; protein-lysine 6-oxidase activity; scavenger receptor activity; transcription corepressor activity

Biological Process: aging; cell adhesion; collagen fibril organization; endothelial cell migration; endothelial cell proliferation; epithelial to mesenchymal transition; histone modification; negative regulation of transcription, DNA-dependent; positive regulation of chondrocyte differentiation; protein amino acid deamination; protein modification process; receptor-mediated endocytosis; response to copper ion; response to hypoxia; sprouting angiogenesis; transcription, DNA-dependent

Similar Products

Product Notes

The LOXL2 loxl2 (Catalog #AAA6177141) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LOXL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LOXL2 loxl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LOXL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.