Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human TMEFF1 Monoclonal Antibody | anti-TMEFF1 antibody

TMEFF1 (Transmembrane Protein with EGF-like and One Follistatin-like Domain, Tomoregulin-1, TR-1, C9orf2, H7365) (MaxLight 550)

Gene Names
TMEFF1; TR-1; H7365; C9orf2; CT120.1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TMEFF1; Monoclonal Antibody; TMEFF1 (Transmembrane Protein with EGF-like and One Follistatin-like Domain; Tomoregulin-1; TR-1; C9orf2; H7365) (MaxLight 550); anti-TMEFF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B1
Specificity
Recognizes human TMEFF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-TMEFF1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa65-173 from TMEFF1 (NP_003683) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SELNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNECFLRRAACKHQKEITVIARGPCYSDNGSGSGEGEEEGSGAEVHRKHSKCGP*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TMEFF1 antibody
MaxLight550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor546, 555, DyLight549, Cy3, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Product Categories/Family for anti-TMEFF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.9 kDa (314aa) confirmed by MALDI-TOF
NCBI Official Full Name
tomoregulin-1
NCBI Official Synonym Full Names
transmembrane protein with EGF like and two follistatin like domains 1
NCBI Official Symbol
TMEFF1
NCBI Official Synonym Symbols
TR-1; H7365; C9orf2; CT120.1
NCBI Protein Information
tomoregulin-1
UniProt Protein Name
Tomoregulin-1
Protein Family
UniProt Gene Name
TMEFF1
UniProt Synonym Gene Names
C9orf2; TR-1
UniProt Entry Name
TEFF1_HUMAN

Uniprot Description

TMEFF1: a single-pass type I membrane protein. May inhibit NODAL and BMP signaling during neural patterning. A member of the Cancer-Testis Antigen (CTA) superfamily. CTAs may play roles in embryonal development and tumor transformation or aspects of tumor progression. CTAs were once thought to be silenced in most normal adult tissues, with limited expression in fetal, placental, testis, and ovarian cells. These proteins are now known to be aberrantly expressed in various cancers and many are capable of eliciting humoral and cellular immune responses. Expressed predominantly in brain, and at lower levels in heart, placenta and skeletal muscle. Down-regulated in brain tumors as compared to control brain tissues. Expressed in a variety of cancers cell lines and in myeloma cells. Belongs to the tomoregulin family. Two isoforms of the human protein are produced by alternative splicing. Note: This description may include information from RefSeq and UniProtKB

Protein type: Cancer Testis Antigen (CTA); Membrane protein, integral

Chromosomal Location of Human Ortholog: 9q31

Cellular Component: plasma membrane; integral to membrane

Biological Process: multicellular organismal development

Research Articles on TMEFF1

Similar Products

Product Notes

The TMEFF1 tmeff1 (Catalog #AAA6214442) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TMEFF1 (Transmembrane Protein with EGF-like and One Follistatin-like Domain, Tomoregulin-1, TR-1, C9orf2, H7365) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMEFF1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TMEFF1 tmeff1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEFF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.