Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SLC6A4 is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human SLC6A4 Monoclonal Antibody | anti-SLC6A4 antibody

SLC6A4 (Solute Carrier Family 6 Member 4, Sodium-dependent Serotonin Transporter, 5HT Transporter, 5HTT, HTT, SERT) (PE)

Gene Names
SLC6A4; HTT; 5HTT; OCD1; SERT; 5-HTT; SERT1; hSERT; 5-HTTLPR
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC6A4; Monoclonal Antibody; SLC6A4 (Solute Carrier Family 6 Member 4; Sodium-dependent Serotonin Transporter; 5HT Transporter; 5HTT; HTT; SERT) (PE); anti-SLC6A4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A9
Specificity
Recognizes human SLC6A4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
630
Applicable Applications for anti-SLC6A4 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa181-253 from human SLC6A4 (NP_001036) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGIS*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SLC6A4 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC6A4 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-SLC6A4 antibody
Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization. Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner.
Product Categories/Family for anti-SLC6A4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
sodium-dependent serotonin transporter
NCBI Official Synonym Full Names
solute carrier family 6 member 4
NCBI Official Symbol
SLC6A4
NCBI Official Synonym Symbols
HTT; 5HTT; OCD1; SERT; 5-HTT; SERT1; hSERT; 5-HTTLPR
NCBI Protein Information
sodium-dependent serotonin transporter
UniProt Protein Name
Sodium-dependent serotonin transporter
UniProt Gene Name
SLC6A4
UniProt Synonym Gene Names
HTT; SERT; 5HTT
UniProt Entry Name
SC6A4_HUMAN

NCBI Description

This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake. There have been conflicting results in the literature about the possible effect, if any, that this polymorphism may play in behavior and depression. [provided by RefSeq, May 2019]

Uniprot Description

SERT: Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization. Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner. Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A4 subfamily.

Protein type: Transporter; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: neuron projection; integral to plasma membrane; plasma membrane; endomembrane system; endosome membrane; cytosol; lipid raft

Molecular Function: actin filament binding; serotonin transmembrane transporter activity; protein binding; protein homodimerization activity; serotonin:sodium symporter activity; myosin binding; cocaine binding; monoamine transmembrane transporter activity; syntaxin-1 binding; nitric-oxide synthase binding; Rab GTPase binding

Biological Process: circadian rhythm; response to drug; vasoconstriction; response to toxin; monoamine transport; positive regulation of cell cycle; thalamus development; social behavior; serotonin uptake; negative regulation of organ growth; negative regulation of synaptic transmission, dopaminergic; protein oligomerization; memory; response to estradiol stimulus; negative regulation of granule cell precursor proliferation; negative regulation of neuron differentiation; response to hypoxia; brain morphogenesis; sperm ejaculation; serotonin transport; transmembrane transport; response to nutrient; protein homooligomerization

Disease: Obsessive-compulsive Disorder; Anxiety

Research Articles on SLC6A4

Similar Products

Product Notes

The SLC6A4 slc6a4 (Catalog #AAA6160356) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC6A4 (Solute Carrier Family 6 Member 4, Sodium-dependent Serotonin Transporter, 5HT Transporter, 5HTT, HTT, SERT) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC6A4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC6A4 slc6a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC6A4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.