Mouse anti-Human TMEFF1 Monoclonal Antibody | anti-TMEFF1 antibody

TMEFF1 (Transmembrane Protein with EGF-like and One Follistatin-like Domain, Tomoregulin-1, TR-1, C9orf2, H7365) (PE)

Cat. Num. AAA6160743

• Gene Names: TMEFF1; TR-1; H7365; C9orf2; CT120.1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TMEFF1; Monoclonal Antibody; TMEFF1 (Transmembrane Protein with EGF-like and One Follistatin-like Domain; Tomoregulin-1; TR-1; C9orf2; H7365) (PE); anti-TMEFF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B1
• Specificity: Recognizes human TMEFF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-TMEFF1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa65-173 from TMEFF1 (NP_003683) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SELNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNECFLRRAACKHQKEITVIARGPCYSDNGSGSGEGEEEGSGAEVHRKHSKCGP*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Testing Data

(Detection limit for recombinant GST tagged TMEFF1 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-TMEFF1 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 29568105
• NCBI GeneID: 8577
• NCBI Accession #: NP_003683
• NCBI GenBank Nucleotide #: NM_003692
• UniProt Accession #: Q8IYR6; Q13086; Q8N3T8
• Molecular Weight: 33.9 kDa (314aa) confirmed by MALDI-TOF
• NCBI Official Full Name: tomoregulin-1
• NCBI Official Synonym Full Names: transmembrane protein with EGF like and two follistatin like domains 1
• NCBI Official Symbol: TMEFF1
• NCBI Official Synonym Symbols: TR-1; H7365; C9orf2; CT120.1
• NCBI Protein Information: tomoregulin-1
• UniProt Protein Name: Tomoregulin-1
• Protein Family: Tomoregulin
• UniProt Gene Name: TMEFF1
• UniProt Synonym Gene Names: C9orf2; TR-1
• UniProt Entry Name: TEFF1_HUMAN

Uniprot Description

TMEFF1: a single-pass type I membrane protein. May inhibit NODAL and BMP signaling during neural patterning. A member of the Cancer-Testis Antigen (CTA) superfamily. CTAs may play roles in embryonal development and tumor transformation or aspects of tumor progression. CTAs were once thought to be silenced in most normal adult tissues, with limited expression in fetal, placental, testis, and ovarian cells. These proteins are now known to be aberrantly expressed in various cancers and many are capable of eliciting humoral and cellular immune responses. Expressed predominantly in brain, and at lower levels in heart, placenta and skeletal muscle. Down-regulated in brain tumors as compared to control brain tissues. Expressed in a variety of cancers cell lines and in myeloma cells. Belongs to the tomoregulin family. Two isoforms of the human protein are produced by alternative splicing. Note: This description may include information from RefSeq and UniProtKB

Protein type: Cancer Testis Antigen (CTA); Membrane protein, integral

Chromosomal Location of Human Ortholog: 9q31

Cellular Component: plasma membrane; integral to membrane

Biological Process: multicellular organismal development