Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for MBS631678 is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human NDST1 Monoclonal Antibody | anti-NDST1 antibody

NDST1 (Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 1, Glucosaminyl N-deacetylase/N-sulfotransferase 1, NDST-1, [Heparan Sulfate]-Glucosamine N-sulfotransferase 1, HSNST 1, N-heparan Sulfate Sulfotransferase 1, N-HSST 1, HSST, HSST1) (Azi

Gene Names
NDST1; HSST; NST1
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Purified
Purified by ammonium sulfate precipitation.
Synonyms
NDST1; Monoclonal Antibody; NDST1 (Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 1; Glucosaminyl N-deacetylase/N-sulfotransferase 1; NDST-1; [Heparan Sulfate]-Glucosamine N-sulfotransferase 1; HSNST 1; N-heparan Sulfate Sulfotransferase 1; N-HSST 1; HSST; HSST1) (Azi; Anti -NDST1 (Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 1; anti-NDST1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
11C463
Specificity
Recognizes human NDST1.
Purity/Purification
Purified
Purified by ammonium sulfate precipitation.
Form/Format
Supplied as a liquid in PBS, pH 7.4. No preservative added
Concentration
0.5 mg/ml (varies by lot)
Sequence
LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI
Applicable Applications for anti-NDST1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Immunohistochemistry and Western Blot.
Immunohistochemistry (Formalin-fixed, paraffin-embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.
Immunogen
Partial recombinant protein corresponding to aa38-136 of human NDST1 (NP_001534) with GST tag. MW of the GST tag alone is 26kD.
Positive Control
Human small intestine, A549 cells.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for MBS631678 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for MBS631678 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of NDST1 expression in A-549 using MBS631678.)

Western Blot (WB) (Western Blot analysis of NDST1 expression in A-549 using MBS631678.)

Immunohistochemistry (IHC)

(Immunoperoxidase on formalin-fixed paraffin-embedded human small Intestine using MBS631678 (3ug/ml).)

Immunohistochemistry (IHC) (Immunoperoxidase on formalin-fixed paraffin-embedded human small Intestine using MBS631678 (3ug/ml).)
Related Product Information for anti-NDST1 antibody
NDST1 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA dissacharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence is absolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands, thereby playing a role in inflammatory response.
Product Categories/Family for anti-NDST1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
NDST1 protein
NCBI Official Synonym Full Names
N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1
NCBI Official Symbol
NDST1
NCBI Official Synonym Symbols
HSST; NST1
NCBI Protein Information
bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1; NDST-1; HSNST 1; N-HSST 1; OTTHUMP00000224347; OTTHUMP00000224348; N-heparan sulfate sulfotransferase 1; glucosaminyl N-deacetylase/N-sulfotransferase 1; heparan sulfate-N-deacetylase/N-sulfotransferase; [Heparan sulfate]-glucosamine N-sulfotransferase 1
UniProt Protein Name
Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
UniProt Gene Name
NDST1
UniProt Synonym Gene Names
HSST; HSST1
UniProt Entry Name
NDST1_HUMAN

NCBI Description

This gene encodes a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. The encoded enzyme is a type II transmembrane protein that resides in the Golgi apparatus. The encoded protein catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate to nitrogen of glucosamine in heparan sulfate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

Uniprot Description

NDST1: Essential bifunctional enzyme that catalyzes both the N- deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence is absolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L- selectin ligands, thereby playing a role in inflammatory response. Belongs to the sulfotransferase 1 family. NDST subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transferase; Glycan Metabolism - heparan sulfate biosynthesis; Hydrolase; EC 2.8.2.8

Chromosomal Location of Human Ortholog: 5q33.1

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: deacetylase activity; [heparan sulfate]-glucosamine N-sulfotransferase activity

Biological Process: smoothened signaling pathway; fibroblast growth factor receptor signaling pathway; glycosaminoglycan metabolic process; MAPKKK cascade; pathogenesis; embryonic viscerocranium morphogenesis; respiratory gaseous exchange; polysaccharide biosynthetic process; glycosaminoglycan biosynthetic process; heparin biosynthetic process; heparan sulfate proteoglycan biosynthetic process; forebrain development; carbohydrate metabolic process; midbrain development; embryonic neurocranium morphogenesis; inflammatory response

Disease: Mental Retardation, Autosomal Recessive 46

Research Articles on NDST1

Similar Products

Product Notes

The NDST1 ndst1 (Catalog #AAA631678) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDST1 (Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 1, Glucosaminyl N-deacetylase/N-sulfotransferase 1, NDST-1, [Heparan Sulfate]-Glucosamine N-sulfotransferase 1, HSNST 1, N-heparan Sulfate Sulfotransferase 1, N-HSST 1, HSST, HSST1) (Azi reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDST1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Immunohistochemistry and Western Blot. Immunohistochemistry (Formalin-fixed, paraffin-embedded): 3ug/ml Optimal dilutions to be determined by the researcher. Researchers should empirically determine the suitability of the NDST1 ndst1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LYGWKRGLE PSADAPEPDC GDPPPVAPSR LLPLKPVQAA TPSRTDPLVL VFVESLYSQL GQEVVAILES SRFKYRTEIA PGKGDMPTLT DKGRGRFALI. It is sometimes possible for the material contained within the vial of "NDST1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.