Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human FBXL18 Monoclonal Antibody | anti-FBXL18 antibody

FBXL18 (F-box and Leucine-rich Repeat Protein 18, F-box/LRR-repeat Protein 18, FBL18, FLJ10776, FLJ11467, FLJ26934, FLJ38075, FLJ41541) (MaxLight 550)

Gene Names
FBXL18; Fbl18
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FBXL18; Monoclonal Antibody; FBXL18 (F-box and Leucine-rich Repeat Protein 18; F-box/LRR-repeat Protein 18; FBL18; FLJ10776; FLJ11467; FLJ26934; FLJ38075; FLJ41541) (MaxLight 550); anti-FBXL18 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3H5
Specificity
Recognizes human FBXL18.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
718
Applicable Applications for anti-FBXL18 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-111 from human FBXL18 (NP_079239) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGS
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-FBXL18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
F-box/LRR-repeat protein 18 isoform 2
NCBI Official Synonym Full Names
F-box and leucine rich repeat protein 18
NCBI Official Symbol
FBXL18
NCBI Official Synonym Symbols
Fbl18
NCBI Protein Information
F-box/LRR-repeat protein 18
Protein Family

NCBI Description

The protein encoded by this gene is a member of a family of proteins that contain an approximately 40-amino acid F-box motif. This motif is important for interaction with SKP1 and for targeting some proteins for degradation. The encoded protein has been shown to control the cellular level of FBXL7, a protein that induces mitotic arrest, by targeting it for polyubiquitylation and proteasomal degradation. Members of the F-box protein family, such as FBXL18, are characterized by an approximately 40-amino acid F-box motif. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains. [provided by RefSeq, Mar 2016]

Research Articles on FBXL18

Similar Products

Product Notes

The FBXL18 (Catalog #AAA6211461) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBXL18 (F-box and Leucine-rich Repeat Protein 18, F-box/LRR-repeat Protein 18, FBL18, FLJ10776, FLJ11467, FLJ26934, FLJ38075, FLJ41541) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXL18 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FBXL18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBXL18, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.