Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human FBXL18 Monoclonal Antibody | anti-FBXL18 antibody

FBXL18 (F-box and Leucine-rich Repeat Protein 18, F-box/LRR-repeat Protein 18, FBL18, FLJ10776, FLJ11467, FLJ26934, FLJ38075, FLJ41541)

Gene Names
FBXL18; Fbl18
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FBXL18; Monoclonal Antibody; FBXL18 (F-box and Leucine-rich Repeat Protein 18; F-box/LRR-repeat Protein 18; FBL18; FLJ10776; FLJ11467; FLJ26934; FLJ38075; FLJ41541); Anti -FBXL18 (F-box and Leucine-rich Repeat Protein 18; anti-FBXL18 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3H5
Specificity
Recognizes human FBXL18.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGS
Applicable Applications for anti-FBXL18 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa1-111 from human FBXL18 (NP_079239) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(FBXL18 monoclonal antibody, Western Blot analysis of FBXL18 expression in A-431.)

Western Blot (WB) (FBXL18 monoclonal antibody, Western Blot analysis of FBXL18 expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FBXL18 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to FBXL18 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged FBXL18 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FBXL18 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-FBXL18 antibody
Members of the F-box protein family, such as FBXL18, are characterized by an approximately 40aa F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).
Product Categories/Family for anti-FBXL18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
88,341 Da
NCBI Official Full Name
FBXL18 protein
NCBI Official Synonym Full Names
F-box and leucine-rich repeat protein 18
NCBI Official Symbol
FBXL18
NCBI Official Synonym Symbols
Fbl18
NCBI Protein Information
F-box/LRR-repeat protein 18
UniProt Protein Name
F-box/LRR-repeat protein 18
Protein Family
UniProt Gene Name
FBXL18
UniProt Synonym Gene Names
FBL18
UniProt Entry Name
FXL18_HUMAN

NCBI Description

Members of the F-box protein family, such as FBXL18, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]

Uniprot Description

FBXL18: Substrate-recognition component of the SCF (SKP1-CUL1-F- box protein)-type E3 ubiquitin ligase complex. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 7p22.2

Similar Products

Product Notes

The FBXL18 fbxl18 (Catalog #AAA6000305) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBXL18 (F-box and Leucine-rich Repeat Protein 18, F-box/LRR-repeat Protein 18, FBL18, FLJ10776, FLJ11467, FLJ26934, FLJ38075, FLJ41541) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXL18 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the FBXL18 fbxl18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASSGEDISN DDDDMHPAAA GMADGVHLLG FSDEILLHIL SHVPSTDLIL NVRRTCRKLA ALCLDKSLIH TVLLQKDYQA SEDKVRQLVK EIGREIQQLS MAGCYWLPGS. It is sometimes possible for the material contained within the vial of "FBXL18, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.