Mouse anti-Human FBXL18 Monoclonal Antibody | anti-FBXL18 antibody

FBXL18 (F-box and Leucine-rich Repeat Protein 18, F-box/LRR-repeat Protein 18, FBL18, FLJ10776, FLJ11467, FLJ26934, FLJ38075, FLJ41541) (PE)

Cat. Num. AAA6157763

• Gene Names: FBXL18; Fbl18
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FBXL18; Monoclonal Antibody; FBXL18 (F-box and Leucine-rich Repeat Protein 18; F-box/LRR-repeat Protein 18; FBL18; FLJ10776; FLJ11467; FLJ26934; FLJ38075; FLJ41541) (PE); anti-FBXL18 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3H5
• Specificity: Recognizes human FBXL18.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 718

• Applicable Applications for anti-FBXL18 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-111 from human FBXL18 (NP_079239) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(FBXL18 monoclonal antibody, Western Blot analysis of FBXL18 expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FBXL18 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged FBXL18 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-FBXL18 antibody

Antibodies; Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 157426875
• NCBI GeneID: 80028
• NCBI Accession #: NP_079239
• NCBI GenBank Nucleotide #: NM_024963
• NCBI Official Full Name: F-box/LRR-repeat protein 18 isoform 2
• NCBI Official Synonym Full Names: F-box and leucine rich repeat protein 18
• NCBI Official Symbol: FBXL18
• NCBI Official Synonym Symbols: Fbl18
• NCBI Protein Information: F-box/LRR-repeat protein 18
• Protein Family: F-box/LRR-repeat protein

NCBI Description

The protein encoded by this gene is a member of a family of proteins that contain an approximately 40-amino acid F-box motif. This motif is important for interaction with SKP1 and for targeting some proteins for degradation. The encoded protein has been shown to control the cellular level of FBXL7, a protein that induces mitotic arrest, by targeting it for polyubiquitylation and proteasomal degradation. Members of the F-box protein family, such as FBXL18, are characterized by an approximately 40-amino acid F-box motif. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains. [provided by RefSeq, Mar 2016]