Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged FEM1B is 0.3ng/ml as a capture antibody.)

Mouse anti-Human F1AA Monoclonal Antibody | anti-F1AA antibody

F1AA (FEM1B, Protein Fem-1 Homolog B, FEM1b, FEM1-beta, Fem-1-like Death Receptor-binding Protein alpha, Fem-1-like in Apoptotic Pathway Protein alpha, F1A-alpha, KIAA0396) (FITC)

Gene Names
FEM1B; F1AA; F1A-ALPHA; FEM1-beta
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
F1AA; Monoclonal Antibody; F1AA (FEM1B; Protein Fem-1 Homolog B; FEM1b; FEM1-beta; Fem-1-like Death Receptor-binding Protein alpha; Fem-1-like in Apoptotic Pathway Protein alpha; F1A-alpha; KIAA0396) (FITC); anti-F1AA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B12
Specificity
Recognizes human FEM1B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
7177
Applicable Applications for anti-F1AA antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa401-490 from FEM1B (NP_056137) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FEM1B is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FEM1B is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-F1AA antibody
FEM1B is involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis, it is involved in glucose homeostasis in pancreatic islet. FEM1B is widely expressed, highest expression being found within the testis while more weakly expressed in other tissues.
Product Categories/Family for anti-F1AA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens fem-1 homolog B (FEM1B), mRNA
NCBI Official Synonym Full Names
fem-1 homolog B
NCBI Official Symbol
FEM1B
NCBI Official Synonym Symbols
F1AA; F1A-ALPHA; FEM1-beta
NCBI Protein Information
protein fem-1 homolog B
UniProt Protein Name
Protein fem-1 homolog B
UniProt Gene Name
FEM1B
UniProt Synonym Gene Names
F1AA; KIAA0396; FEM1b; F1A-alpha
UniProt Entry Name
FEM1B_HUMAN

NCBI Description

This gene encodes an ankyrin repeat protein that belongs to the death receptor-associated family of proteins and plays a role in mediating apoptosis. The encoded protein is also thought to function in the replication stress-induced checkpoint signaling pathway via interaction with checkpoint kinase 1. [provided by RefSeq, Aug 2013]

Uniprot Description

FEM1B: Component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. Involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. Also involved in glucose homeostasis in pancreatic islet. Functions as an adapter/mediator in replication stress-induced signaling that leads to the activation of CHEK1. Belongs to the fem-1 family.

Protein type: Cell development/differentiation; Ligase; Ubiquitin conjugating system; Apoptosis

Chromosomal Location of Human Ortholog: 15q22

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding; death receptor binding; ubiquitin-protein ligase activity

Biological Process: regulation of ubiquitin-protein ligase activity; apoptosis; protein ubiquitination

Research Articles on F1AA

Similar Products

Product Notes

The F1AA fem1b (Catalog #AAA6147118) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The F1AA (FEM1B, Protein Fem-1 Homolog B, FEM1b, FEM1-beta, Fem-1-like Death Receptor-binding Protein alpha, Fem-1-like in Apoptotic Pathway Protein alpha, F1A-alpha, KIAA0396) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's F1AA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the F1AA fem1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "F1AA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.