Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:1: 30ug HEK293T cell lysate, 2: 30ug 3DYKDDDDK-hFEM1B transfected HEK293T cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:8000Gene Name:FEM1BSubmitted by:AnonymousFEM1B is strongly supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit FEM1B Polyclonal Antibody | anti-FEM1B antibody

FEM1B antibody - middle region

Gene Names
FEM1B; F1AA; F1A-ALPHA; FEM1-beta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FEM1B; Polyclonal Antibody; FEM1B antibody - middle region; anti-FEM1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRE
Sequence Length
627
Applicable Applications for anti-FEM1B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FEM1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:1: 30ug HEK293T cell lysate, 2: 30ug 3DYKDDDDK-hFEM1B transfected HEK293T cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:8000Gene Name:FEM1BSubmitted by:AnonymousFEM1B is strongly supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (Lanes:1: 30ug HEK293T cell lysate, 2: 30ug 3DYKDDDDK-hFEM1B transfected HEK293T cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:8000Gene Name:FEM1BSubmitted by:AnonymousFEM1B is strongly supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-FEM1B antibody
This is a rabbit polyclonal antibody against FEM1B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FEM1B is a component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. It involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. FEM1B also involved in glucose homeostasis in pancreatic islet.
Product Categories/Family for anti-FEM1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
protein fem-1 homolog B
NCBI Official Synonym Full Names
fem-1 homolog B
NCBI Official Symbol
FEM1B
NCBI Official Synonym Symbols
F1AA; F1A-ALPHA; FEM1-beta
NCBI Protein Information
protein fem-1 homolog B
UniProt Protein Name
Protein fem-1 homolog B
UniProt Gene Name
FEM1B
UniProt Synonym Gene Names
F1AA; KIAA0396; FEM1b; F1A-alpha
UniProt Entry Name
FEM1B_HUMAN

NCBI Description

This gene encodes an ankyrin repeat protein that belongs to the death receptor-associated family of proteins and plays a role in mediating apoptosis. The encoded protein is also thought to function in the replication stress-induced checkpoint signaling pathway via interaction with checkpoint kinase 1. [provided by RefSeq, Aug 2013]

Uniprot Description

FEM1B: Component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. Involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. Also involved in glucose homeostasis in pancreatic islet. Functions as an adapter/mediator in replication stress-induced signaling that leads to the activation of CHEK1. Belongs to the fem-1 family.

Protein type: Cell development/differentiation; Ligase; Ubiquitin conjugating system; Apoptosis

Chromosomal Location of Human Ortholog: 15q22

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding; death receptor binding; ubiquitin-protein ligase activity

Biological Process: regulation of ubiquitin-protein ligase activity; apoptosis; protein ubiquitination

Research Articles on FEM1B

Similar Products

Product Notes

The FEM1B fem1b (Catalog #AAA3211456) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FEM1B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FEM1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FEM1B fem1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FQDGDNILEK EVLPPIHAYG NRTECRNPQE LESIRQDRDA LHMEGLIVRE. It is sometimes possible for the material contained within the vial of "FEM1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.