Mouse anti-Human F1AA Monoclonal Antibody | anti-F1AA antibody

F1AA (FEM1B, Protein Fem-1 Homolog B, FEM1b, FEM1-beta, Fem-1-like Death Receptor-binding Protein alpha, Fem-1-like in Apoptotic Pathway Protein alpha, F1A-alpha, KIAA0396) (PE)

Cat. Num. AAA6157724

• Gene Names: FEM1B; F1AA; F1A-ALPHA; FEM1-beta
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: F1AA; Monoclonal Antibody; F1AA (FEM1B; Protein Fem-1 Homolog B; FEM1b; FEM1-beta; Fem-1-like Death Receptor-binding Protein alpha; Fem-1-like in Apoptotic Pathway Protein alpha; F1A-alpha; KIAA0396) (PE); anti-F1AA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4B12
• Specificity: Recognizes human FEM1B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 7177

• Applicable Applications for anti-F1AA antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa401-490 from FEM1B (NP_056137) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FEM1B is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-F1AA antibody

FEM1B is involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis, it is involved in glucose homeostasis in pancreatic islet. FEM1B is widely expressed, highest expression being found within the testis while more weakly expressed in other tissues.

Product Categories/Family for anti-F1AA antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 1519242803
• NCBI GeneID: 10116
• NCBI Accession #: NM_015322.5
• NCBI GenBank Nucleotide #: NM_015322
• UniProt Accession #: Q9UK73
• NCBI Official Full Name: Homo sapiens fem-1 homolog B (FEM1B), mRNA
• NCBI Official Synonym Full Names: fem-1 homolog B
• NCBI Official Symbol: FEM1B
• NCBI Official Synonym Symbols: F1AA; F1A-ALPHA; FEM1-beta
• NCBI Protein Information: protein fem-1 homolog B
• UniProt Protein Name: Protein fem-1 homolog B
• UniProt Gene Name: FEM1B
• UniProt Synonym Gene Names: F1AA; KIAA0396; FEM1b; F1A-alpha
• UniProt Entry Name: FEM1B_HUMAN

NCBI Description

This gene encodes an ankyrin repeat protein that belongs to the death receptor-associated family of proteins and plays a role in mediating apoptosis. The encoded protein is also thought to function in the replication stress-induced checkpoint signaling pathway via interaction with checkpoint kinase 1. [provided by RefSeq, Aug 2013]

Uniprot Description

FEM1B: Component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. Involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. Also involved in glucose homeostasis in pancreatic islet. Functions as an adapter/mediator in replication stress-induced signaling that leads to the activation of CHEK1. Belongs to the fem-1 family.

Protein type: Cell development/differentiation; Ligase; Ubiquitin conjugating system; Apoptosis

Chromosomal Location of Human Ortholog: 15q22

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding; death receptor binding; ubiquitin-protein ligase activity

Biological Process: regulation of ubiquitin-protein ligase activity; apoptosis; protein ubiquitination