Mouse anti-Human DOCK4 Monoclonal Antibody | anti-DOCK4 antibody

DOCK4 (Dedicator of Cytokinesis Protein 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (AP)

Cat. Num. AAA6130988

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DOCK4; Monoclonal Antibody; DOCK4 (Dedicator of Cytokinesis Protein 4; FLJ34238; KIAA0716; MGC134911; MGC134912) (AP); anti-DOCK4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3E7
• Specificity: Recognizes human DOCK4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 1966

• Applicable Applications for anti-DOCK4 antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1867-1966 from DOCK4 (NP_055520) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(DOCK4 monoclonal antibody. Western Blot analysis of DOCK4 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DOCK4 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DOCK4 on HeLa cell. [antibody concentration 10ug/ml.)

Testing Data

(Detection limit for recombinant GST tagged DOCK4 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-DOCK4 antibody

Antibodies; Apoptosis

References

1. Identification of novel posttranscriptional targets of the BCR/ABL oncoprotein by ribonomics: requirement of E2F3 for BCR/ABL leukemogenesis.Eiring AM, Neviani P, Santhanam R, Oaks JJ, Chang JS, Notari M, Willis W, Gambacorti-Passerini C, Volinia S, Marcucci G, Caligiuri MA, Leone GW, Perrotti D.Blood. 2008 Jan 15;111(2):816-28. Epub 2007 Oct 9.

NCBI and Uniprot Product Information

• NCBI GI #: 92091572
• NCBI GeneID: 9732
• NCBI Accession #: NP_055520
• NCBI GenBank Nucleotide #: NM_014705
• UniProt Accession #: Q8N1I0
• NCBI Official Full Name: dedicator of cytokinesis protein 4 isoform 1
• NCBI Official Synonym Full Names: dedicator of cytokinesis 4
• NCBI Official Symbol: DOCK4
• NCBI Protein Information: dedicator of cytokinesis protein 4
• UniProt Protein Name: Dedicator of cytokinesis protein 4
• Protein Family: Dedicator of cytokinesis protein
• UniProt Gene Name: DOCK4
• UniProt Synonym Gene Names: KIAA0716

NCBI Description

This gene is a member of the dedicator of cytokinesis (DOCK) family and encodes a protein with a DHR-1 (CZH-1) domain, a DHR-2 (CZH-2) domain and an SH3 domain. This membrane-associated, cytoplasmic protein functions as a guanine nucleotide exchange factor and is involved in regulation of adherens junctions between cells. Mutations in this gene have been associated with ovarian, prostate, glioma, and colorectal cancers. Alternatively spliced variants which encode different protein isoforms have been described, but only one has been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

Involved in regulation of adherens junction between cells. Plays a role in cell migration. Functions as a guanine nucleotide exchange factor (GEF), which activates Rap1 small GTPase by exchanging bound GDP for free GTP.