Rabbit NXF3 Polyclonal Antibody | anti-NXF3 antibody

NXF3 antibody - C-terminal region

Cat. Num. AAA3205520

• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Protein A purified
• Synonyms: NXF3; Polyclonal Antibody; NXF3 antibody - C-terminal region; anti-NXF3 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Protein A purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: SSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSS
• Sequence Length: 531

• Applicable Applications for anti-NXF3 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 92%; Dog: 92%; Guinea Pig: 77%; Horse: 79%; Human: 100%; Pig: 92%; Rabbit: 92%; Rat: 77%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NXF3
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-NXF3 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-NXF3 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-NXF3 Antibody Titration: 1.25ug/mlPositive Control: RPMI 8226 cell lysateNXF3 is supported by BioGPS gene expression data to be expressed in RPMI 8226)

Related Product Information for anti-NXF3 antibody

This is a rabbit polyclonal antibody against NXF3. It was validated on Western Blot and immunohistochemistry

Target Description: NXF3 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF3 has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus.This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. The encoded protein of this gene has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus.

Product Categories/Family for anti-NXF3 antibody

Polyclonal; RNA Binding Proteins; Chromatin & Nuclear Signaling; E3 & Ubiquitin; DNA/RNA/Protein Interactions; Immunohistochemistry

NCBI and Uniprot Product Information

• NCBI GI #: 11545757
• NCBI GeneID: 56000
• NCBI Accession #: NP_071335
• NCBI GenBank Nucleotide #: NM_022052
• UniProt Accession #: Q9H4D5
• Molecular Weight: 58kDa
• NCBI Official Full Name: nuclear RNA export factor 3
• NCBI Official Synonym Full Names: nuclear RNA export factor 3
• NCBI Official Symbol: NXF3
• NCBI Protein Information: nuclear RNA export factor 3
• UniProt Protein Name: Nuclear RNA export factor 3
• Protein Family: Nuclear RNA export factor
• UniProt Gene Name: NXF3
• UniProt Synonym Gene Names: TAPL3; TAPL-3
• UniProt Entry Name: NXF3_HUMAN

NCBI Description

This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. The encoded protein of this gene has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus. [provided by RefSeq, Jul 2008]

Uniprot Description

NXF3: May function as a tissue-specific nuclear mRNA export factor. Belongs to the NXF family.

Chromosomal Location of Human Ortholog: Xq22

Cellular Component: nucleoplasm; nuclear RNA export factor complex; cytoplasm; nucleus

Molecular Function: mRNA binding; protein binding; nucleotide binding

Biological Process: poly(A)+ mRNA export from nucleus; mRNA export from nucleus