Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human DOCK4 Monoclonal Antibody | anti-DOCK4 antibody

DOCK4 (Dedicator of Cytokinesis Protein 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (Biotin)

Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DOCK4; Monoclonal Antibody; DOCK4 (Dedicator of Cytokinesis Protein 4; FLJ34238; KIAA0716; MGC134911; MGC134912) (Biotin); anti-DOCK4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3E7
Specificity
Recognizes human DOCK4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1966
Applicable Applications for anti-DOCK4 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1867-1966 from DOCK4 (NP_055520) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(DOCK4 monoclonal antibody. Western Blot analysis of DOCK4 expression in HeLa.)

Western Blot (WB) (DOCK4 monoclonal antibody. Western Blot analysis of DOCK4 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DOCK4 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to DOCK4 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DOCK4 on HeLa cell. [antibody concentration 10ug/ml.)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DOCK4 on HeLa cell. [antibody concentration 10ug/ml.)

Testing Data

(Detection limit for recombinant GST tagged DOCK4 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DOCK4 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-DOCK4 antibody
References
1. Identification of novel posttranscriptional targets of the BCR/ABL oncoprotein by ribonomics: requirement of E2F3 for BCR/ABL leukemogenesis.Eiring AM, Neviani P, Santhanam R, Oaks JJ, Chang JS, Notari M, Willis W, Gambacorti-Passerini C, Volinia S, Marcucci G, Caligiuri MA, Leone GW, Perrotti D.Blood. 2008 Jan 15;111(2):816-28. Epub 2007 Oct 9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
dedicator of cytokinesis protein 4 isoform 1
NCBI Official Synonym Full Names
dedicator of cytokinesis 4
NCBI Official Symbol
DOCK4
NCBI Protein Information
dedicator of cytokinesis protein 4
UniProt Protein Name
Dedicator of cytokinesis protein 4
UniProt Gene Name
DOCK4
UniProt Synonym Gene Names
KIAA0716

NCBI Description

This gene is a member of the dedicator of cytokinesis (DOCK) family and encodes a protein with a DHR-1 (CZH-1) domain, a DHR-2 (CZH-2) domain and an SH3 domain. This membrane-associated, cytoplasmic protein functions as a guanine nucleotide exchange factor and is involved in regulation of adherens junctions between cells. Mutations in this gene have been associated with ovarian, prostate, glioma, and colorectal cancers. Alternatively spliced variants which encode different protein isoforms have been described, but only one has been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

Involved in regulation of adherens junction between cells. Plays a role in cell migration. Functions as a guanine nucleotide exchange factor (GEF), which activates Rap1 small GTPase by exchanging bound GDP for free GTP.

Research Articles on DOCK4

Similar Products

Product Notes

The DOCK4 dock4 (Catalog #AAA6141594) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DOCK4 (Dedicator of Cytokinesis Protein 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DOCK4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DOCK4 dock4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DOCK4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.