Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-MRPL51 Polyclonal Antibody)

Rabbit anti-Mouse, Rat MRPL51 Polyclonal Antibody | anti-MRPL51 antibody

MRPL51 Polyclonal Antibody

Gene Names
MRPL51; CDA09; MRP64; bMRP64; HSPC241
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
MRPL51; Polyclonal Antibody; MRPL51 Polyclonal Antibody; CDA09; HSPC241; MRP64; bMRP64; mitochondrial ribosomal protein L51; anti-MRPL51 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.28 mg/ml (varies by lot)
Sequence Length
128
Applicable Applications for anti-MRPL51 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPL51 (NP_057581.2).
Immunogen Sequence
MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR
Positive Samples
Mouse Kidney, Rat Heart, Rat Kidney
Cellular Location
Mitochondrion
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-MRPL51 Polyclonal Antibody)

Western Blot (WB) (Western blot-MRPL51 Polyclonal Antibody)
Related Product Information for anti-MRPL51 antibody
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 4p and 21q.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 15kDa
Observed: 14kDa
NCBI Official Full Name
39S ribosomal protein L51, mitochondrial
NCBI Official Synonym Full Names
mitochondrial ribosomal protein L51
NCBI Official Symbol
MRPL51
NCBI Official Synonym Symbols
CDA09; MRP64; bMRP64; HSPC241
NCBI Protein Information
39S ribosomal protein L51, mitochondrial
UniProt Protein Name
39S ribosomal protein L51, mitochondrial
Protein Family
UniProt Gene Name
MRPL51
UniProt Synonym Gene Names
MRP64; L51mt; MRP-L51; bMRP64
UniProt Entry Name
RM51_HUMAN

NCBI Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 4p and 21q. [provided by RefSeq, Jul 2008]

Uniprot Description

MRPL51: Component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins.

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 12p13.3-p13.1

Cellular Component: mitochondrial inner membrane; mitochondrial ribosome; mitochondrial large ribosomal subunit

Molecular Function: protein binding; structural constituent of ribosome

Biological Process: mitochondrial translation; translation; organelle organization and biogenesis

Research Articles on MRPL51

Similar Products

Product Notes

The MRPL51 mrpl51 (Catalog #AAA9140546) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRPL51 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MRPL51 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the MRPL51 mrpl51 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MRPL51, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.