Mouse anti-Human CCL4L1 Monoclonal Antibody | anti-CCL4L1 antibody

CCL4L1 (C-C Motif Chemokine 4-like, Small-inducible Cytokine A4-like, Monocyte Adherence-induced Protein 5-alpha, Macrophage Inflammatory Protein 1-beta, MIP-1-beta, Lymphocyte Activation Gene 1 Protein, LAG-1, CCL4L, LAG1, SCYA4L1, CCL4L2, CCL4L, SCYA4L2

Cat. Num. AAA6156918

• Gene Names: CCL4L1; LAG1; CCL4L; LAG-1; SCYA4L; AT744.2; SCYA4L1; SCYA4L2; MIP-1-beta
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CCL4L1; Monoclonal Antibody; CCL4L1 (C-C Motif Chemokine 4-like; Small-inducible Cytokine A4-like; Monocyte Adherence-induced Protein 5-alpha; Macrophage Inflammatory Protein 1-beta; MIP-1-beta; Lymphocyte Activation Gene 1 Protein; LAG-1; CCL4L; LAG1; SCYA4L1; CCL4L2; SCYA4L2; anti-CCL4L1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G8
• Specificity: Recognizes human CCL4L2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 92

• Applicable Applications for anti-CCL4L1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa28-93 from human CCL4L2 (NP_996890) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.26kD).)

Related Product Information for anti-CCL4L1 antibody

CCL4L1 is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein is similar to CCL4 which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals; most individuals have 1-5 copies in the diploid genome, although rare individuals do not contain this gene at all. The human genome reference assembly contains two copies of this gene. This record represents the more centromeric gene.

Product Categories/Family for anti-CCL4L1 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 46275832
• NCBI GeneID: 388372
• NCBI Accession #: NP_996890
• NCBI GenBank Nucleotide #: NM_207007
• NCBI Official Full Name: C-C motif chemokine 4-like
• NCBI Official Synonym Full Names: C-C motif chemokine ligand 4 like 1
• NCBI Official Symbol: CCL4L1
• NCBI Official Synonym Symbols: LAG1; CCL4L; LAG-1; SCYA4L; AT744.2; SCYA4L1; SCYA4L2; MIP-1-beta
• NCBI Protein Information: C-C motif chemokine 4-like
• Protein Family: C-C motif chemokine

NCBI Description

This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this family member is similar to the chemokine (C-C motif) ligand 4 product, which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals, where most individuals have one to five copies. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2014]