Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged BBC3 is 0.03 ng/ml as a capture antibody.)

Mouse BBC3 Monoclonal Antibody | anti-BBC3 antibody

BBC3 (BCL2 Binding Component 3, JFY1, PUMA) (Biotin)

Gene Names
BBC3; JFY1; PUMA; JFY-1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
BBC3; Monoclonal Antibody; BBC3 (BCL2 Binding Component 3; JFY1; PUMA) (Biotin); BCL2 Binding Component 3; PUMA; anti-BBC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5D10
Specificity
Recognizes BBC3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-BBC3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
BBC3 (NP_055232.1, 98aa-152aa) partial recombinant protein with GST tag.
Immunogen Sequence
SLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQY
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged BBC3 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BBC3 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-BBC3 antibody
Mouse monoclonal antibody raised against a partial recombinant BBC3.
Product Categories/Family for anti-BBC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,326 Da
NCBI Official Full Name
bcl-2-binding component 3 isoform 4
NCBI Official Synonym Full Names
BCL2 binding component 3
NCBI Official Symbol
BBC3
NCBI Official Synonym Symbols
JFY1; PUMA; JFY-1
NCBI Protein Information
bcl-2-binding component 3; p53 up-regulated modulator of apoptosis
UniProt Protein Name
Bcl-2-binding component 3
Protein Family
UniProt Gene Name
BBC3
UniProt Synonym Gene Names
PUMA
UniProt Entry Name
BBC3_HUMAN

NCBI Description

This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It can bind to anti-apoptotic Bcl-2 family members to induce mitochondrial dysfunction and caspase activation. Because of its pro-apoptotic role, this gene is a potential drug target for cancer therapy and for tissue injury. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011]

Uniprot Description

PUMA: Essential mediator of p53/TP53-dependent and p53/TP53- independent apoptosis. Interacts with MCL1 and BCL2A1. Interacts with BCL2 and BCL2L1/BCL-XL. By DNA damage, glucocorticoid treatment, growth factor deprivation and p53/TP53. Ubiquitously expressed. Belongs to the Bcl-2 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 19q13.3-q13.4

Cellular Component: mitochondrial outer membrane; mitochondrion; cytosol

Molecular Function: protein binding

Biological Process: caspase activation; release of cytochrome c from mitochondria; positive regulation of protein homooligomerization; apoptosis; reduction of endoplasmic reticulum calcium ion concentration; positive regulation of neuron apoptosis; release of sequestered calcium ion into cytosol; determination of adult life span; response to DNA damage stimulus; negative regulation of growth

Research Articles on BBC3

Similar Products

Product Notes

The BBC3 bbc3 (Catalog #AAA6174686) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BBC3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BBC3 bbc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BBC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.