Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ALDH4A1 on formalin-fixed paraffin-embedded human liver tissue.[antibody concentration 5ug/ml].)

Mouse anti-Human ALDH4A1 Monoclonal Antibody | anti-ALDH4A1 antibody

ALDH4A1 (Aldehyde Dehydrogenase Family 4 Member A1, Delta-1-pyrroline-5-carboxylate Dehydrogenase, Mitochondrial, P5C Dehydrogenase, ALDH4, P5CDH)

Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ALDH4A1; Monoclonal Antibody; ALDH4A1 (Aldehyde Dehydrogenase Family 4 Member A1; Delta-1-pyrroline-5-carboxylate Dehydrogenase; Mitochondrial; P5C Dehydrogenase; ALDH4; P5CDH); Anti -ALDH4A1 (Aldehyde Dehydrogenase Family 4 Member A1; anti-ALDH4A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A12-A5
Specificity
Recognizes human ALDH4A1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLP
Applicable Applications for anti-ALDH4A1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Immunohistochemistry and Western Blot.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml
Immunogen
Full length recombinant corresponding to aa1-564 from ALDH4A1 (AAH07581) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ALDH4A1 on formalin-fixed paraffin-embedded human liver tissue.[antibody concentration 5ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ALDH4A1 on formalin-fixed paraffin-embedded human liver tissue.[antibody concentration 5ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ALDH4A1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ALDH4A1 is 0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of ALDH4A1 expression in transfected 293T cell line by ALDH4A1 monoclonal antibody |Lane 1: ALDH4A1 transfected lysate (61.7kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ALDH4A1 expression in transfected 293T cell line by ALDH4A1 monoclonal antibody |Lane 1: ALDH4A1 transfected lysate (61.7kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB)

(ALDH4A1 monoclonal antibody Western Blot analysis of ALDH4A1 expression in A-431.)

Western Blot (WB) (ALDH4A1 monoclonal antibody Western Blot analysis of ALDH4A1 expression in A-431.)
Related Product Information for anti-ALDH4A1 antibody
ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.
Product Categories/Family for anti-ALDH4A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
61,495 Da
NCBI Official Full Name
ALDH4A1 protein
NCBI Official Synonym Full Names
aldehyde dehydrogenase 4 family, member A1
NCBI Official Symbol
ALDH4A1
NCBI Protein Information
delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; P5C dehydrogenase; aldehyde dehydrogenase family 4 member A1
UniProt Protein Name
Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
UniProt Gene Name
ALDH4A1
UniProt Synonym Gene Names
P5C dehydrogenase
UniProt Entry Name
AL4A1_BOVIN

Uniprot Description

Function: Irreversible conversion of delta-1-pyrroline-5-carboxylate (P5C), derived either from proline or ornithine, to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes

By similarity.

Catalytic activity: L-glutamate 5-semialdehyde + NAD+ + H2O = L-glutamate + NADH.

Pathway: Amino-acid degradation; L-proline degradation into L-glutamate; L-glutamate from L-proline: step 2/2.

Subunit structure: Homodimer

By similarity.

Subcellular location: Mitochondrion matrix

By similarity.

Sequence similarities: Belongs to the aldehyde dehydrogenase family.

Similar Products

Product Notes

The ALDH4A1 aldh4a1 (Catalog #AAA647226) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ALDH4A1 (Aldehyde Dehydrogenase Family 4 Member A1, Delta-1-pyrroline-5-carboxylate Dehydrogenase, Mitochondrial, P5C Dehydrogenase, ALDH4, P5CDH) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH4A1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Immunohistochemistry and Western Blot. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml. Researchers should empirically determine the suitability of the ALDH4A1 aldh4a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLLPAPALRR ALLSRPWTGA GLRWKHTSSL KVANEPVLAF TQGSPERDAL QKALKDLKGR MEAIPCVVGD EEVWTSDVQY QVSPFNHGHK VAKFCYADKS LLNKAIEAAL AARKEWDLKP IADRAQIFLK AADMLSGPRR AEILAKTMVG QGKTVIQAEI DAAAELIDFF RFNAKYAVEL EGQQPISVPP STNSTVYRGL EGFVAAISPF NFTAIGGNLA GAPALMGNVV LWKPSDTAML ASYAVYRILR EAGLP. It is sometimes possible for the material contained within the vial of "ALDH4A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.