Rabbit anti-Human, Mouse CLTB Polyclonal Antibody | anti-CLTB antibody

CLTB (Clathrin Light Chain B, Lcb) (HRP)

Cat. Num. AAA6374207

• Gene Names: CLTB; LCB
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CLTB; Polyclonal Antibody; CLTB (Clathrin Light Chain B; Lcb) (HRP); anti-CLTB antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CLTB. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-CLTB antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CLTB, aa1-211 (NP_001825.1).
• Immunogen Sequence: MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CLTB rabbit polyclonal antibody. Western Blot analysis of CLTB expression in human stomach.)

Western Blot (WB)

(CLTB rabbit polyclonal antibody. Western Blot analysis of CLTB expression in mouse spleen.)

Western Blot (WB)

(Western Blot analysis of CLTB expression in transfected 293T cell line by CLTB rabbit polyclonal antibody. Lane 1: CLTB transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CLTB antibody

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.

Product Categories/Family for anti-CLTB antibody

Antibodies; Clathrin

NCBI and Uniprot Product Information

• NCBI GI #: 4502901
• NCBI GeneID: 1212
• NCBI Accession #: NP_001825.1
• NCBI GenBank Nucleotide #: NM_001834
• UniProt Accession #: P09497; Q53Y37; Q6FHW1
• Molecular Weight: 23,181 Da
• NCBI Official Full Name: clathrin light chain B isoform a
• NCBI Official Synonym Full Names: clathrin, light chain B
• NCBI Official Symbol: CLTB
• NCBI Official Synonym Symbols: LCB
• NCBI Protein Information: clathrin light chain B; clathrin, light chain (Lcb); clathrin, light polypeptide (Lcb)
• UniProt Protein Name: Clathrin light chain B
• Protein Family: Clathrin
• UniProt Gene Name: CLTB
• UniProt Synonym Gene Names: Lcb
• UniProt Entry Name: CLCB_HUMAN

NCBI Description

Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

CLTB: Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Clathrin coats are formed from molecules containing 3 heavy chains and 3 light chains. Interacts (via N-terminus) with HIP1. Interacts with HIP1R. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 5q35

Cellular Component: clathrin coat of trans-Golgi network vesicle; clathrin coat; intracellular membrane-bound organelle; cytoplasm; plasma membrane; trans-Golgi network; clathrin coat of coated pit

Molecular Function: protein binding; structural molecule activity; peptide binding

Biological Process: vesicle-mediated transport; intracellular protein transport