Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit alpha (CSF2RA) Active Protein | CSF2RA active protein

Recombinant Human Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit alpha (CSF2RA), Partial

Cat. Num. AAA7114956

• Gene Names: CSF2RA; GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; alphaGMR; GM-CSF-R-alpha
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit alpha (CSF2RA); Recombinant Human Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit alpha (CSF2RA); Partial; Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha; GM-CSF-R-Alpha; GMCSFR-Alpha; GMR-Alpha; CDw116; CD116; CSF2RA; CSF2R; CSF2RY; CSF2RA active protein

• Host: Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Sequence Positions: 23-320aa; Partial
• Sequence: EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG
• Sequence Length: 400

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to inhibit GM-CSF-dependent proliferation of TF-1 human erythroleukemic cells is less than 5 ng/ml.
• Subcellular Location: Cell Membrane, Single-Pass Type I Membrane Protein, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted
• Protein Families: Type I Cytokine Receptor Family, Type 5 Subfamily
• Classification: Cytokine
• Subdivision: Colony Stimulating Factor
• Pathway: Jak-STAT Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for CSF2RA active protein

Relevance: Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit alpha (CSF2RA) is a single-pass type I membrane protein which belongs to the type I cytokine receptor family of Type 5 subfamily. The CSF2RA gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes with some of the isoforms being membrane-bound and others being soluble. CSF2RA is a low affinity receptor for granulocyte-macrophage colony-stimulating factor. CSF2RA transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. Defects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4).

Function: Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.

Product Categories/Family for CSF2RA active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 238908515
• NCBI GeneID: 1438
• NCBI Accession #: NP_001155001.1
• NCBI GenBank Nucleotide #: NM_001161529.1
• UniProt Accession #: P15509
• Molecular Weight: 35.5 kDa
• NCBI Official Full Name: granulocyte-macrophage colony-stimulating factor receptor subunit alpha isoform a
• NCBI Official Synonym Full Names: colony stimulating factor 2 receptor alpha subunit
• NCBI Official Symbol: CSF2RA
• NCBI Official Synonym Symbols: GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; alphaGMR; GM-CSF-R-alpha
• NCBI Protein Information: granulocyte-macrophage colony-stimulating factor receptor subunit alpha
• UniProt Protein Name: Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
• Protein Family: Granulocyte-macrophage colony-stimulating factor receptor
• UniProt Gene Name: CSF2RA
• UniProt Synonym Gene Names: CSF2R; CSF2RY; GM-CSF-R-alpha; GMCSFR-alpha; GMR-alpha
• UniProt Entry Name: CSF2R_HUMAN

NCBI Description

The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq, Jul 2008]

Uniprot Description

CSF2RA: Low affinity receptor for granulocyte-macrophage colony- stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. Defects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4). A rare lung disorder due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid-Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress. Belongs to the type I cytokine receptor family. Type 5 subfamily. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: Xp22.32 and Yp11.3

Cellular Component: integral to plasma membrane; extracellular region; plasma membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; receptor activity

Biological Process: response to ethanol; cytokine and chemokine mediated signaling pathway

Disease: Surfactant Metabolism Dysfunction, Pulmonary, 4