Alpha-2-macroglobulin receptor-associated (Lrpap1) Recombinant Protein | Lrpap1 recombinant protein
Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial
Gene Names
Lrpap1; RAP; HBP44; C77774; AA617339; AI790446; AU042172
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-2-macroglobulin receptor-associated (Lrpap1); Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1); partial; Heparin-binding protein 44; Lrpap1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyop
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyop
Sequence Positions
248-360aa, Partial
Sequence
GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Species
Mouse
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Function
Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Product Categories/Family for Lrpap1 recombinant protein
References
"Lipoprotein receptor-related protein in brain and in cultured neurons of mice deficient in receptor-associated protein and transgenic for apolipoprotein E4 or amyloid precursor protein."Umans L., Serneels L., Lorent K., Dewachter I., Tesseur I., Moechars D., Van Leuven F.Neuroscience 94:315-321 (1999)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,215 Da
NCBI Official Full Name
alpha-2-macroglobulin receptor-associated protein
NCBI Official Synonym Full Names
low density lipoprotein receptor-related protein associated protein 1
NCBI Official Symbol
Lrpap1
NCBI Official Synonym Symbols
RAP; HBP44; C77774; AA617339; AI790446; AU042172
NCBI Protein Information
alpha-2-macroglobulin receptor-associated protein
UniProt Protein Name
Alpha-2-macroglobulin receptor-associated protein
Protein Family
UniProt Gene Name
Lrpap1
UniProt Synonym Gene Names
Alpha-2-MRAP; HBP-44; RAP
UniProt Entry Name
AMRP_MOUSE
Uniprot Description
LRPAP1: Interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330. In complex with the alpha-2-MR or gp330, it may have some role in the pathogenesis of membrane glomerular nephritis. Belongs to the alpha-2-MRAP family.
Protein type: Receptor, misc.
Cellular Component: cytoplasm; endoplasmic reticulum; plasma membrane; rough endoplasmic reticulum; vesicle
Molecular Function: low-density lipoprotein receptor binding; receptor antagonist activity
Biological Process: negative regulation of protein binding
Similar Products
Product Notes
The Lrpap1 lrpap1 (Catalog #AAA7136938) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 248-360aa, Partial. The amino acid sequence is listed below: GYGSTTEFEE PRVIDLWDLA QSANFTEKEL ESFREELKHF EAKIEKHNHY QKQLEISHQK LKHVESIGDP EHISRNKEKY VLLEEKTKEL GYKVKKHLQD LSSRVSRARH NEL. It is sometimes possible for the material contained within the vial of "Alpha-2-macroglobulin receptor-associated (Lrpap1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
