Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Mouse IL-17A Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 17-26 kDa.)

IL-17A active protein

Recombinant Mouse IL-17A Protein

Gene Names
Il17a; Il17; Ctla8; IL-17; Ctla-8; IL-17A
Purity
>95% by SDS-PAGE.
Synonyms
IL-17A; Recombinant Mouse IL-17A Protein; Interleukin-17A; IL-17; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; _+E_CTLA8; IL17; IL-17A active protein
Ordering
For Research Use Only!
Host
Mammalian
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Sequence Length
158
Species
Mouse
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.25-1.25 ng/ml.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Mouse IL-17A Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 17-26 kDa.)

SDS-Page (Recombinant Mouse IL-17A Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 17-26 kDa.)
Related Product Information for IL-17A active protein
Description: Recombinant Mouse IL-17A Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Thr22-Ala158) of mouse IL-17A (Accession #Q62386) fused with a 6xHis tag at the C-terminus.

Background: This protein is a pro-inflammatory cytokine that is a member of the interleukin-17 family. The encoded protein plays a central role in host defense against diverse pathogens. The encoded protein is produced by activated T-cells and certain cell types of innate immune system. The active protein functions as either a homodimer with other interleukin-17 family members and signals through the interleukin-17 receptor to induce inflammatory cytokine production. Aberrant expression of this gene is associated with autoinflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.
Product Categories/Family for IL-17A active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-17A
NCBI Official Synonym Full Names
interleukin 17A
NCBI Official Symbol
Il17a
NCBI Official Synonym Symbols
Il17; Ctla8; IL-17; Ctla-8; IL-17A
NCBI Protein Information
interleukin-17A
UniProt Protein Name
Interleukin-17A
UniProt Gene Name
Il17a
UniProt Synonym Gene Names
Ctla8; Il17; IL-17; IL-17A; CTLA-8
UniProt Entry Name
IL17_MOUSE

NCBI Description

This gene encodes a pro-inflammatory cytokine that is a member of the interleukin-17 family. The encoded protein plays a central role in host defense against diverse pathogens. The encoded protein is produced by activated T-cells and certain cell types of innate immune system. The active protein functions as either a homodimer with other interleukin-17 family members and signals through the interleukin-17 receptor to induce inflammatory cytokine production. Aberrant expression of this gene is associated with autoinflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. [provided by RefSeq, Sep 2015]

Uniprot Description

IL17A: Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of ICAM1/intracellular adhesion molecule 1 in fibroblasts. Belongs to the IL-17 family.

Protein type: Secreted, signal peptide; Secreted

Cellular Component: extracellular space; cytoplasm; extracellular region; external side of plasma membrane

Molecular Function: cytokine activity

Biological Process: positive regulation of osteoclast differentiation; positive regulation of interleukin-23 production; positive regulation of transcription from RNA polymerase II promoter; inflammatory response

Research Articles on IL-17A

Similar Products

Product Notes

The IL-17A il17a (Catalog #AAA9141693) is an Active Protein produced from Mammalian and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TVKAAAIIPQ SSACPNTEAK DFLQNVKVNL KVFNSLGAKV SSRRPSDYLN RSTSPWTLHR NEDPDRYPSV IWEAQCRHQR CVNAEGKLDH HMNSVLIQQE ILVLKREPES CPFTFRVEKM LVGVGCTCVA SIVRQAA. It is sometimes possible for the material contained within the vial of "IL-17A, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.