CD126 recombinant protein

CD126 Recombinant Protein

Cat. Num. AAA3003885

• Gene Names: IL6R; IL6Q; gp80; CD126; IL6RA; IL6RQ; IL-6RA; IL-6R-1
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD126; CD126 Recombinant Protein; CD126 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 1050
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD126 recombinant protein

Background: The IL-6 receptor is a heterodimeric complex that consists of a ligand-binding IL-6 receptor alpha (IL-6Ralpha) subunit and a signaling component, gp130. Binding of IL-6 to IL-6Ralpha results in dimerization of receptor with gp130 and subsequent STAT3 activation (1). IL-6Ralpha is cleaved from the cell surface by ADAM17. In humans, soluble IL-6Ralpha is also generated via alternatively spliced mRNA. Soluble IL-6Ralpha binds to IL-6 and can stimulate signaling via membrane bound gp130 in a process known as "trans-signaling". It is through trans-signaling that IL-6 stimulates cells that do not express membrane bound IL-6Ralpha.

NCBI and Uniprot Product Information

• NCBI GI #: 633863
• NCBI GeneID: 3570
• UniProt Accession #: P08887; Q16202; Q53EQ7; Q5FWG2; Q5VZ23; A8KAE8; B2R6V4
• Molecular Weight: 51,548 Da
• NCBI Official Full Name: Soluble interleukin-6 receptor
• NCBI Official Synonym Full Names: interleukin 6 receptor
• NCBI Official Symbol: IL6R
• NCBI Official Synonym Symbols: IL6Q; gp80; CD126; IL6RA; IL6RQ; IL-6RA; IL-6R-1
• NCBI Protein Information: interleukin-6 receptor subunit alpha; IL-6R 1; CD126 antigen; membrane glycoprotein 80; IL-6 receptor subunit alpha
• UniProt Protein Name: Interleukin-6 receptor subunit alpha
• UniProt Gene Name: IL6R
• UniProt Synonym Gene Names: IL-6 receptor subunit alpha; IL-6R subunit alpha; IL-6R-alpha; IL-6RA; gp80
• UniProt Entry Name: IL6RA_HUMAN

NCBI Description

This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9.[provided by RefSeq, May 2011]

Uniprot Description

IL6R: Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis. Belongs to the type I cytokine receptor family. Type 3 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: extracellular space; basolateral plasma membrane; apical plasma membrane; extracellular region; plasma membrane; interleukin-6 receptor complex

Molecular Function: protein binding; interleukin-6 binding; protein homodimerization activity; enzyme binding; interleukin-6 receptor binding; ciliary neurotrophic factor receptor activity; interleukin-6 receptor activity

Biological Process: positive regulation of smooth muscle cell proliferation; negative regulation of collagen biosynthetic process; cytokine and chemokine mediated signaling pathway; neutrophil mediated immunity; positive regulation of interleukin-6 production; positive regulation of leukocyte chemotaxis; defense response to Gram-negative bacterium; endocrine pancreas development; positive regulation of chemokine production; activation of NF-kappaB transcription factor; positive regulation of tyrosine phosphorylation of Stat3 protein; monocyte chemotaxis; positive regulation of osteoblast differentiation; positive regulation of peptidyl-tyrosine phosphorylation; defense response to Gram-positive bacterium; positive regulation of MAPKKK cascade; response to cytokine stimulus; positive regulation of cell proliferation; acute-phase response; negative regulation of interleukin-8 production; hepatic immune response

Disease: Interleukin 6, Serum Level Of, Quantitative Trait Locus; Soluble Interleukin-6 Receptor, Serum Level Of, Quantitative Trait Locus