Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human 2B4/SLAMF/CD244 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 70-90 kDa.)

2B4/SLAMF/CD244 Active Protein | 2B4 active protein

Recombinant Human 2B4/SLAMF/CD244 Protein

Gene Names
CD244; 2B4; NAIL; Nmrk; NKR2B4; SLAMF4
Purity
>95% by SDS-PAGE.
Synonyms
2B4/SLAMF/CD244; Recombinant Human 2B4/SLAMF/CD244 Protein; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4; 2B4 active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized recombinant human CD48 at 5 ug/mL (100 uL/well) can bind recombinant human CD244 with a linear range of 0.2-1 ug/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human 2B4/SLAMF/CD244 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 70-90 kDa.)

SDS-Page (Recombinant Human 2B4/SLAMF/CD244 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 70-90 kDa.)
Related Product Information for 2B4 active protein
Description: Recombinant Human 2B4/SLAMF/CD244 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Cys22-Arg221) of human 2B4/SLAMF/CD244 (Accession #NP_057466.1) fused with an Fc, 6xHis tag at the C-terminus.

Background: Cluster of differentiation 24, also known as signal transducer CD24 or heat stable antigen CD24 (HSA), is a mucin-type glycosylphosphatidylinositol-linked glycoprotein expressed on the surface of B-cells, differentiating neuroblasts and many tumors. It is involved in molecular adhesion and metastatic tumor spread and serve as a normal receptor for P-selectin. The CD24 / P-selectin pathway could be important in dissimenating of tumor cells by facilitating the interaction with platelet and endothelial cells. It has also been considered as a tumor marker. High rate of CD24 expressions have been found in epithelial ovarian cancer, breast cancer, non-small cell lung cancer, prostate cancer and pancreatic cancer.
Product Categories/Family for 2B4 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Synonym Full Names
CD244 molecule
NCBI Official Symbol
CD244
NCBI Official Synonym Symbols
2B4; NAIL; Nmrk; NKR2B4; SLAMF4
NCBI Protein Information
natural killer cell receptor 2B4
UniProt Protein Name
Natural killer cell receptor 2B4
UniProt Gene Name
CD244
UniProt Synonym Gene Names
2B4; NAIL; NKR2B4; h2B4; SLAMF4
UniProt Entry Name
CD244_HUMAN

NCBI Description

This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]

Uniprot Description

CD244: Modulate other receptor-ligand interactions to enhance leukocyte activation. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: plasma membrane; integral to membrane; external side of plasma membrane

Molecular Function: protein binding; receptor activity

Biological Process: signal transduction; blood coagulation; leukocyte migration

Disease: Rheumatoid Arthritis

Research Articles on 2B4

Similar Products

Product Notes

The 2B4 cd244 (Catalog #AAA9141721) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LEPLPIVYYV GRKPKVEQLS NMIVRSCKCS. It is sometimes possible for the material contained within the vial of "2B4/SLAMF/CD244, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.