Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data ()

CD244 recombinant protein

CD244 Recombinant Protein

Gene Names
CD244; 2B4; NAIL; Nmrk; NKR2B4; SLAMF4
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD244; CD244 Recombinant Protein; CD244 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWP
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
636
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Testing Data ()
Related Product Information for CD244 recombinant protein
Background: 2B4, also known as signaling lymphocytic activation molecule family member 4 (SLAMF4) and cluster of differentiation 244 (CD244), is a heterophilic cell surface receptor expressed on a variety of immune cells, including natural killer (NK) cells, T cells, eosinophils, mast cells, and dendritic cells. 2B4 has been shown to have both immune stimulatory and inhibitory effects on cells. Upon engagement of its ligand CD48, 2B4 can enhance immune cell signaling, cytokine production, non-major histocompatibility complex-restricted cytotoxicity, and cell migration. Conversely, at early stages of NK cell differentiation, 2B4 may function as an inhibitory receptor possibly ensuring the self-tolerance of developing NK cells. 2B4 also inhibits inflammatory responses in dendritic cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
370
NCBI Official Full Name
Natural killer cell receptor 2B4
NCBI Official Synonym Full Names
CD244 molecule, natural killer cell receptor 2B4
NCBI Official Symbol
CD244
NCBI Official Synonym Symbols
2B4; NAIL; Nmrk; NKR2B4; SLAMF4
NCBI Protein Information
natural killer cell receptor 2B4; h2B4; SLAM family member 4; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; NK cell activation inducing ligand NAIL; signaling lymphocytic activation molecule 4
UniProt Protein Name
Natural killer cell receptor 2B4
UniProt Gene Name
CD244
UniProt Synonym Gene Names
2B4; NAIL; NKR2B4; h2B4; SLAMF4
UniProt Entry Name
CD244_HUMAN

NCBI Description

This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]

Uniprot Description

CD244: Modulate other receptor-ligand interactions to enhance leukocyte activation. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: plasma membrane; integral to membrane; external side of plasma membrane

Molecular Function: protein binding; receptor activity

Biological Process: signal transduction; blood coagulation; leukocyte migration

Disease: Rheumatoid Arthritis

Research Articles on CD244

Similar Products

Product Notes

The CD244 cd244 (Catalog #AAA3003532) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: CQGSADHVVS ISGVPLQLQP NSIQTKVDSI AWKKLLPSQN GFHHILKWEN GSLPSNTSND RFSFIVKNLS LLIKAAQQQD SGLYCLEVTS ISGKVQTATF QVFVFESLLP DKVEKPRLQG QGKILDRGRC QVALSCLVSR DGNVSYAWYR GSKLIQTAGN LTYLDEEVDI NGTHTYTCNV SNPVSWESHT LNLTQDCQNA HQEFRFWP. It is sometimes possible for the material contained within the vial of "CD244, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.