Trifunctional enzyme subunit alpha, mitochondrial (Hadha) Recombinant Protein | Hadha recombinant protein

Recombinant Mouse Trifunctional enzyme subunit alpha, mitochondrial (Hadha), partial

Cat. Num. AAA1344217

• Gene Names: Hadha; Mtpa; C77020
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Trifunctional enzyme subunit alpha; mitochondrial (Hadha); Recombinant Mouse Trifunctional enzyme subunit alpha; partial; Hadha recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 348-763aa; Partial
• Sequence: LCKKNKFGAPQKNVQQLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGRGQQQVFKGLNDKVKKKALTSFERDSIFSNLIGQLDYKGFEKADMVIEAVFEDLGVKHKVLKEVESVTPEHCIFASNTSALPINQIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLRQGKVIIVVKDGPGFYTTRCLAPMMSEVMRILQEGVDPKKLDALTTGFGFPVGAATLADEVGVDVAQHVAEDLGKAFGERFGGGSVELLKQMVSKGFLGRKSGKGFYIYQEGSKNKSLNSEMDNILANLRLPAKPEVSSDEDVQYRVITRFVNEAVLCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKVVDRLRKYESAYGTQFTPCQLLLDHANNSSKKFYQ
• Sequence Length: 763

• Species: Mouse
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Hadha recombinant protein

This gene encodes the alpha subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the alpha subunit catalyzing the 3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase activities. Mutations in this gene result in trifunctional protein deficiency or LCHAD deficiency. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation.

NCBI and Uniprot Product Information

• NCBI GI #: 33859811
• NCBI GeneID: 97212
• NCBI Accession #: NP_849209.1
• NCBI GenBank Nucleotide #: NM_178878.2
• UniProt Accession #: Q8BMS1; Q3TCY3; Q5U5Y5; Q8QZU4
• Molecular Weight: 50.1 kDa
• NCBI Official Full Name: trifunctional enzyme subunit alpha, mitochondrial
• NCBI Official Synonym Full Names: hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit
• NCBI Official Symbol: Hadha
• NCBI Official Synonym Symbols: Mtpa; C77020
• NCBI Protein Information: trifunctional enzyme subunit alpha, mitochondrial
• UniProt Protein Name: Trifunctional enzyme subunit alpha, mitochondrial
• Protein Family: Trifunctional enzyme
• UniProt Gene Name: Hadha

Uniprot Description

Bifunctional subunit.