Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using HADHA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Rabbit anti-Human, Mouse HADHA Polyclonal Antibody | anti-HADHA antibody

HADHA Polyclonal Antibody

Gene Names
HADHA; GBP; ECHA; HADH; LCEH; MTPA; LCHAD; TP-ALPHA
Reactivity
Human, Mouse
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
HADHA; Polyclonal Antibody; HADHA Polyclonal Antibody; ECHA; GBP; HADH; LCEH; LCHAD; MTPA; TP-ALPHA; anti-HADHA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
IAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEA
Sequence Length
763
Applicable Applications for anti-HADHA antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human HADHA
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Mitochondrion
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using HADHA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using HADHA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human liver cancer using HADHA antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human liver cancer using HADHA antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human esophageal cancer using HADHA antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human esophageal cancer using HADHA antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-HADHA antibody
This gene encodes the alpha subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the alpha subunit catalyzing the 3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase activities. Mutations in this gene result in trifunctional protein deficiency or LCHAD deficiency. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation.
Product Categories/Family for anti-HADHA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 28kDa; 83kDa
Observed: 88kDa
NCBI Official Full Name
trifunctional enzyme subunit alpha, mitochondrial
NCBI Official Synonym Full Names
hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit alpha
NCBI Official Symbol
HADHA
NCBI Official Synonym Symbols
GBP; ECHA; HADH; LCEH; MTPA; LCHAD; TP-ALPHA
NCBI Protein Information
trifunctional enzyme subunit alpha, mitochondrial
UniProt Protein Name
Trifunctional enzyme subunit alpha, mitochondrial
Protein Family
UniProt Gene Name
HADHA
UniProt Synonym Gene Names
HADH

NCBI Description

This gene encodes the alpha subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the alpha subunit catalyzing the 3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase activities. Mutations in this gene result in trifunctional protein deficiency or LCHAD deficiency. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. [provided by RefSeq, Jul 2008]

Uniprot Description

Bifunctional subunit.

Research Articles on HADHA

Similar Products

Product Notes

The HADHA hadha (Catalog #AAA9133355) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HADHA Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HADHA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200 IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the HADHA hadha for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IAAVSKRPEK VIGMHYFSPV DKMQLLEIIT TEKTSKDTSA SAVAVGLKQG KVIIVVKDGP GFYTTRCLAP MMSEVIRILQ EGVDPKKLDS LTTSFGFPVG AATLVDEVGV DVAKHVAEDL GKVFGERFGG GNPELLTQMV SKGFLGRKSG KGFYIYQEGV KRKDLNSDMD SILASLKLPP KSEVSSDEDI QFRLVTRFVN EAVMCLQEGI LATPAEGDIG AVFGLGFPPC LGGPFRFVDL YGAQKIVDRL KKYEA. It is sometimes possible for the material contained within the vial of "HADHA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.