Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

IP-10 (CXCL10) active protein

Human IP-10 (CXCL10)

Gene Names
CXCL10; C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
Reactivity
Human
Purity
> 98 % (SDS-PAGE, HPLC)
Synonyms
IP-10 (CXCL10); Human IP-10 (CXCL10); Recombinant Human IP-10; IP-10 (CXCL10) active protein
Ordering
For Research Use Only!
Host
E Coli
Reactivity
Human
Purity/Purification
> 98 % (SDS-PAGE, HPLC)
Form/Format
Lyophilized
Sequence
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGE KRCLNPESKAIKNLLKAVSKERSKRSP
Sequence Length
98
Endotoxin Level
< 0.1 ng/ug of IP-10
Biological Activity
Determined by its ability to chemoattract human T-Lymphocytes using a concentration of 10-50 ng/ml.
Related Product Information for IP-10 (CXCL10) active protein
IP-10 is a CXC chemokine that signals through the CXCR3 receptor. IP-10 selectively chemoattracts Th1 lymphocytes and monocytes, and inhibits cytokine-stimulated hematopoietic progenitor cell proliferation. Additionally, it is angiostatic and mitogenic for vascular smooth muscle cells. Recombinant human IP-10 is an 8.6 kDa protein consisting of 77 amino acids including the four conserved cysteine residues present in CXC chemokines.
Product Categories/Family for IP-10 (CXCL10) active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8.5 kDa
NCBI Official Full Name
C-X-C motif chemokine 10
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 10
NCBI Official Symbol
CXCL10
NCBI Official Synonym Symbols
C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
NCBI Protein Information
C-X-C motif chemokine 10; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10
UniProt Protein Name
C-X-C motif chemokine 10
UniProt Gene Name
CXCL10
UniProt Synonym Gene Names
INP10; SCYB10; Gamma-IP10; IP-10
UniProt Entry Name
CXL10_HUMAN

NCBI Description

This gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Subcellular location: Secreted.

Induction: By IFNG/IFN-gamma. A diverse population of cell types rapidly increases transcription of mRNA encoding this protein. This suggests that gamma-induced protein may be a key mediator of the IFNG/IFN-gamma response.

Post-translational modification: CXCL10(1-73) is produced by proteolytic cleavage after secretion from keratinocytes.

Sequence similarities: Belongs to the intercrine alpha (chemokine CxC) family.

Mass spectrometry: Molecular mass is 8641.8 Da from positions 22 - 98. Determined by ESI. Ref.5

Research Articles on IP-10 (CXCL10)

Similar Products

Product Notes

The IP-10 (CXCL10) cxcl10 (Catalog #AAA691791) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human IP-10 (CXCL10) reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: VPLSRTVRCT CISISNQPVN PRSLEKLEII PASQFCPRVE IIATMKKKGE KRCLNPESKA IKNLLKAVSK ERSKRSP. It is sometimes possible for the material contained within the vial of "IP-10 (CXCL10), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.