C-X-C motif chemokine 10 Recombinant Protein | INP10 recombinant protein

Recombinant Human C-X-C motif chemokine 10 protein

Cat. Num. AAA949181

• Gene Names: CXCL10; C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-X-C motif chemokine 10; Recombinant Human C-X-C motif chemokine 10 protein; 10 kDa interferon gamma-induced protein; Gamma-IP10; IP-10; Small-inducible cytokine B10; INP10 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 22-98aa; Full Length
• Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
• Sequence Length: 98

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for INP10 recombinant protein

Chotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Product Categories/Family for INP10 recombinant protein

Immunology

References

Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins.Luster A.D., Unkeless J.C., Ravetch J.V.Nature 315:672-676(1985) Identification of a novel granulocyte chemotactic protein (GCP-2) from human tumor cells. In vitro and in vivo comparison with natural forms of GRO, IP-10, and IL-8.Proost P., de Wolf-Peeters C., Conings R., Opdenakker G., Billiau A., van Damme J.J. Immunol. 150:1000-1010(1993) Human IP-9 a keratinocyte derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3) .Tensen C.P., Flier J., van der Raaij-Helmer E.M.H., Sampat-Sardjoepersad S., van der Schors R.C., Leurs R., Scheper R.J., Boorsma D.M., Willemze R.J. Invest. Dermatol. 112:716-722(1999) Processing of natural and recombinant CXCR3-targeting chemokines and implications for biological activity.Hensbergen P.J., van der Raaij-Helmer E.M.H., Dijkman R., van der Schors R.C., Werner-Felmayer G., Boorsma D.M., Scheper R.J., Willemze R., Tensen C.P.Eur. J. Biochem. 268:4992-4999(2001) Citrullination of CXCL10 and CXCL11 by peptidylarginine deiminase a naturally occurring posttranslational modification of chemokines and new dimension of immunoregulation.Loos T., Mortier A., Gouwy M., Ronsse I., Put W., Lenaerts J.P., Van Damme J., Proost P.Blood 112:2648-2656(2008) The CXCR3 binding chemokine IP-10/CXCL10 structure and receptor interactions.Booth V., Keizer D.W., Kamphuis M.B., Clark-Lewis I., Sykes B.D.Biochemistry 41:10418-10425(2002)

NCBI and Uniprot Product Information

• NCBI GI #: 149999382
• NCBI GeneID: 3627
• NCBI Accession #: NP_001556.2
• NCBI GenBank Nucleotide #: NM_001565.3
• UniProt Accession #: P02778; Q96QJ5
• Molecular Weight: 12.7kD
• NCBI Official Full Name: C-X-C motif chemokine 10
• NCBI Official Synonym Full Names: chemokine (C-X-C motif) ligand 10
• NCBI Official Symbol: CXCL10
• NCBI Official Synonym Symbols: C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• NCBI Protein Information: C-X-C motif chemokine 10
• UniProt Protein Name: C-X-C motif chemokine 10
• Protein Family: C-X-C motif chemokine
• UniProt Gene Name: CXCL10
• UniProt Synonym Gene Names: INP10; SCYB10; Gamma-IP10; IP-10
• UniProt Entry Name: CXL10_HUMAN

NCBI Description

This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq, Sep 2014]

Uniprot Description

CXCL10: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Secreted; Secreted, signal peptide; Motility/polarity/chemotaxis; Chemokine

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: external side of plasma membrane; extracellular region; extracellular space

Molecular Function: cAMP-dependent protein kinase regulator activity; chemokine activity; CXCR3 chemokine receptor binding; heparin binding; protein binding; receptor binding

Biological Process: blood circulation; cell surface receptor linked signal transduction; cell-cell signaling; chemotaxis; defense response to virus; endothelial cell activation; G-protein coupled receptor protein signaling pathway; immune response; inflammatory response; muscle development; negative regulation of angiogenesis; negative regulation of myoblast differentiation; positive regulation of cAMP metabolic process; positive regulation of cell proliferation; positive regulation of release of sequestered calcium ion into cytosol; positive regulation of transcription from RNA polymerase II promoter; regulation of cell proliferation; regulation of protein kinase activity; response to cold; response to gamma radiation; response to vitamin D; signal transduction