Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IFNA1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)

IFNA1 active protein

Recombinant Human IFNA1 Protein

Purity
>97% by SDS-PAGE.
Synonyms
IFNA1; Recombinant Human IFNA1 Protein; IFL; IFN; IFN-ALPHA; IFN-alphaD; IFNA13; IFNA; IFNA1 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYAQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
Sequence Length
189
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to stimulate GBP2 expression in 293T human embryonic kidney cells.0.1-1ng/mL of Recombinant Human IFNA1 can effectively Stimulating GBP2 expression.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IFNA1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)

SDS-Page (Recombinant Human IFNA1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)
Related Product Information for IFNA1 active protein
Description: Recombinant Human IFNA1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys24-Glu189 (Ala114)) of human IFNA1 (Accession #NP_076918.1) fused with an initial Met at the N-terminus and a 6xHis tag at the C-terminus.

Background: IFNA1, also known as IFN-alpha and IFNA, belongs to the alpha/beta interferon family. Interferons(IFNs) are proteins made and released by host cells in response to the presence of pathogens such as viruses, bacteria, parasites or tumor cells.Leukocyte interferon is produced predominantly by B lymphocytes. Immune interferon is produced by mitogen- or antigen-stimulated T lymphocytes. IFNA1 is produced by macrophages and has has both anti-viral and immunomodulatory activities on target cells.
Product Categories/Family for IFNA1 active protein

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
NCBI Official Full Name
Interferon alpha-1/13
UniProt Protein Name
Interferon alpha-1/13
Protein Family
UniProt Gene Name
IFNA1
UniProt Synonym Gene Names
IFN-alpha-1/13; LeIF D
UniProt Entry Name
IFNA1_HUMAN

Uniprot Description

IFNA1/13: a cytokine that belongs to the alpha/beta interferon family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 9p22

Cellular Component: extracellular space; extracellular region

Molecular Function: interferon-alpha/beta receptor binding; cytokine activity

Biological Process: B cell proliferation; adaptive immune response; cytokine and chemokine mediated signaling pathway; regulation of MHC class I biosynthetic process; humoral immune response; T cell activation during immune response; response to exogenous dsRNA; B cell differentiation; natural killer cell activation during immune response; innate immune response; blood coagulation; defense response to virus; positive regulation of peptidyl-serine phosphorylation of STAT protein

Similar Products

Product Notes

The IFNA1 ifna1 (Catalog #AAA9139614) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: CDLPETHSLD NRRTLMLLAQ MSRISPSSCL MDRHDFGFPQ EEFDGNQFQK APAISVLHEL IQQIFNLFTT KDSSAAWDED LLDKFCTELY AQLNDLEACV MQEERVGETP LMNADSILAV KKYFRRITLY LTEKKYSPCA WEVVRAEIMR SLSLSTNLQE RLRRKE. It is sometimes possible for the material contained within the vial of "IFNA1, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.