CCL28 active protein

Human CCL28, biotinylated

Cat. Num. AAA191493

• Gene Names: CCL28; MEC; CCK1; SCYA28
• Purity: >97%
• Synonyms: CCL28; Human CCL28; biotinylated; CCL28 active protein

• Host: E Coli
• Purity/Purification: >97%
• Form/Format: Lyophilized
• Sequence: ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRR ICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQG KHETYGHKTPY
• Sequence Length: 127

• Source: Human
• Endotoxin: <0.01 EU per 1ug of protein by LAL method
• Activity: EC50 = 40-60nM determined by Migration Assay of recombinant cells expressing CCR10.
• Modification: Biotinylated
• Reconstitution: Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.
• Carrier Protein: None
• Preparation and Storage: 12 months from date of receipt,-20 degree C to-70 degree C, as supplied.; 1 month,-20 degree C to-70 degree C, under sterile conditions after reconstitution.; Best if used immediately after reconstitution.; Avoid multiple freeze-thaw cycles.

Related Product Information for CCL28 active protein

CCL28, also known as Mucosae-associated Epithelial Chemokine (MEC), is secreted by gastrointestinal and non-intestinal mucosal cells. It regulates chemotaxis of cells expressing surface receptors CCR3 and CCR10. This chemokine is constitutively expressed in the colon, but its levels can be increased by pro-inflammatory cytokines and certain bacterial products implying a role in effector cell recruitment to sites of epithelial injury. CCL28 has also been implicated in the migration of IgA-expressing cells to the mammary gland, salivary gland, intestine and other mucosal tissues. It has also been shown as a potential antimicrobial agent effective against certain pathogens, such as Gram negative and Gram positive bacteria and the fungus Candida albicans.

NCBI and Uniprot Product Information

• NCBI GI #: 687569447
• NCBI GeneID: 56477
• NCBI Accession #: NP_001288802.1
• NCBI GenBank Nucleotide #: NM_001301873.1
• UniProt Accession #: Q9NRJ3; D7RIE7
• Molecular Weight: 14.3kDa by Mass Spec.
• NCBI Official Full Name: C-C motif chemokine 28 isoform a
• NCBI Official Synonym Full Names: C-C motif chemokine ligand 28
• NCBI Official Symbol: CCL28
• NCBI Official Synonym Symbols: MEC; CCK1; SCYA28
• NCBI Protein Information: C-C motif chemokine 28
• UniProt Protein Name: C-C motif chemokine 28
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL28
• UniProt Synonym Gene Names: SCYA28; MEC

NCBI Description

This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for resting CD4 or CD8 T cells and eosinophils. The product of this gene binds to chemokine receptors CCR3 and CCR10. This chemokine may play a role in the physiology of extracutaneous epithelial tissues, including diverse mucosal organs. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]

Uniprot Description

Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner.