Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DnaJ homolog subfamily C member 14 (Dnajc14) Recombinant Protein | Dnajc14 recombinant protein

Recombinant Rat DnaJ homolog subfamily C member 14 (Dnajc14)

Gene Names
Dnajc14; Drip78
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DnaJ homolog subfamily C member 14 (Dnajc14); Recombinant Rat DnaJ homolog subfamily C member 14 (Dnajc14); Dnajc14 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-703aa; full length protein
Sequence
MAQKHPGERGLCGVHHSGGSSLITSGSSVDPEILSFSGLRDSKETAPNGTRCLKEHSDPK CTQPPNPAHWSDPSHGPPRGPGPPREGGYPDESETCSEESGVDQELSRENETGYQEDGSP SFLPIPSACNCQGSPGVPEGTCSEEGDGSSSSFCHHCTSPALGEDEELEEEYDDEEPLKF PSDFSRVSSGKKPPSRRQRHRFLTKEDVRDSGRRDPKAPGRHRLARKRSQTDKRRGLGLW GVEELCQLGQAGFWWLIELLVLVGEYVETCGYLIYACRKLKGSDLDLFRIWVGVWARRLG GWARVMFQFLSQSFFSVAGLFIRLLRVVGAFLLLALALFLGCLQLGWRFLVGLGDRLGWR GKAAWLFSWLDSPALHHFLTLLKDSRPWQQLVRVIQWGWLELPWVKQRTQRQGTAHVASG RYCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDIELKKAYRQLAVMVHPDKNHHPR AEEAFKVLRAAWDIVSNPERRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSR CQGKHRRFEMDREPKSARYCAECNRLHPAEEGDFWAESSMLGLKITYFALMDGKVYDITE WAGCQRVGISPDTHRVPYHISFGSRVPGTSGRQRATPESPPADLQDFLSRIFQVPPGPMS NGNFFAAPHPGPGTTSTSRPNSSVPKGEAKPKRRKKVRRPFQR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Dnajc14 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79,017 Da
NCBI Official Full Name
dnaJ homolog subfamily C member 14
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member C14
NCBI Official Symbol
Dnajc14
NCBI Official Synonym Symbols
Drip78
NCBI Protein Information
dnaJ homolog subfamily C member 14
UniProt Protein Name
DnaJ homolog subfamily C member 14
Protein Family
UniProt Gene Name
Dnajc14
UniProt Synonym Gene Names
Drip78; DRiP78
UniProt Entry Name
DJC14_RAT

NCBI Description

ER-membrane-associated protein; may be involved in ER export regulation of a GPCR [RGD, Feb 2006]

Uniprot Description

DNAJC14: Regulates the export of target proteins, such as DRD1, from the endoplasmic reticulum to the cell surface.

Protein type: Membrane protein, integral; Endoplasmic reticulum; Chaperone; Membrane protein, multi-pass

Cellular Component: endoplasmic reticulum membrane; integral to membrane; membrane; nucleolus; nucleoplasm

Molecular Function: dopamine receptor binding; G-protein-coupled receptor binding

Biological Process: protein transport

Similar Products

Product Notes

The Dnajc14 dnajc14 (Catalog #AAA7013808) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-703aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Dnajc14 dnajc14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAQKHPGERG LCGVHHSGGS SLITSGSSVD PEILSFSGLR DSKETAPNGT RCLKEHSDPK CTQPPNPAHW SDPSHGPPRG PGPPREGGYP DESETCSEES GVDQELSREN ETGYQEDGSP SFLPIPSACN CQGSPGVPEG TCSEEGDGSS SSFCHHCTSP ALGEDEELEE EYDDEEPLKF PSDFSRVSSG KKPPSRRQRH RFLTKEDVRD SGRRDPKAPG RHRLARKRSQ TDKRRGLGLW GVEELCQLGQ AGFWWLIELL VLVGEYVETC GYLIYACRKL KGSDLDLFRI WVGVWARRLG GWARVMFQFL SQSFFSVAGL FIRLLRVVGA FLLLALALFL GCLQLGWRFL VGLGDRLGWR GKAAWLFSWL DSPALHHFLT LLKDSRPWQQ LVRVIQWGWL ELPWVKQRTQ RQGTAHVASG RYCQPEEEVA RLLTMAGVPE DELNPFHVLG VEATASDIEL KKAYRQLAVM VHPDKNHHPR AEEAFKVLRA AWDIVSNPER RKEYEMKRMA ENELSRSVNE FLSKLQDDLK EAMNTMMCSR CQGKHRRFEM DREPKSARYC AECNRLHPAE EGDFWAESSM LGLKITYFAL MDGKVYDITE WAGCQRVGIS PDTHRVPYHI SFGSRVPGTS GRQRATPESP PADLQDFLSR IFQVPPGPMS NGNFFAAPHP GPGTTSTSRP NSSVPKGEAK PKRRKKVRRP FQR. It is sometimes possible for the material contained within the vial of "DnaJ homolog subfamily C member 14 (Dnajc14), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.