Rho GDP-dissociation inhibitor 1 Recombinant Protein | GDIA1 recombinant protein

Recombinant Human Rho GDP-dissociation inhibitor 1 protein

Cat. Num. AAA717046

• Gene Names: ARHGDIA; GDIA1; NPHS8; RHOGDI; RHOGDI-1; HEL-S-47e
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Rho GDP-dissociation inhibitor 1; Recombinant Human Rho GDP-dissociation inhibitor 1 protein; Rho-GDI alpha; GDIA1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 2-204aa; Full Length
• Sequence: AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
• Sequence Length: 204

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for GDIA1 recombinant protein

Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from th, and the subsequent binding of GTP to th. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting th from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SA5A and PLXNB3 that lead to inactivation of RAC1.

Product Categories/Family for GDIA1 recombinant protein

Signal Transduction

References

Identification of two human Rho GDP dissociation inhibitor proteins whose overexpression leads to disruption of the actin cytoskeleton.Leffers H., Nielsen M.S., Andersen A.H., Honore B., Madsen P., Vandekerckhove J., Celis J.E.Exp. Cell Res. 209:165-174(1993)

NCBI and Uniprot Product Information

• NCBI GI #: 297374782
• NCBI GeneID: 396
• NCBI Accession #: NP_001172006.1
• NCBI GenBank Nucleotide #: NM_001185077.2
• UniProt Accession #: P52565; Q6IBM5; A8MXW0; B2R5X1; B4DDD3; B4DUV9
• Molecular Weight: 50.1 kDa
• NCBI Official Full Name: rho GDP-dissociation inhibitor 1 isoform a
• NCBI Official Synonym Full Names: Rho GDP dissociation inhibitor (GDI) alpha
• NCBI Official Symbol: ARHGDIA
• NCBI Official Synonym Symbols: GDIA1; NPHS8; RHOGDI; RHOGDI-1; HEL-S-47e
• NCBI Protein Information: rho GDP-dissociation inhibitor 1
• UniProt Protein Name: Rho GDP-dissociation inhibitor 1
• Protein Family: Rho GDP-dissociation inhibitor
• UniProt Gene Name: ARHGDIA
• UniProt Synonym Gene Names: GDIA1; Rho GDI 1
• UniProt Entry Name: GDIR1_HUMAN

NCBI Description

This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

RhoGDI alpha: Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Monomer. Forms a heterodimer with RAC1. Interacts with FER. Belongs to the Rho GDI family.

Protein type: Motility/polarity/chemotaxis; G protein regulator, misc.; Apoptosis; Cell adhesion; Cell development/differentiation

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: cytoskeleton; cytosol

Molecular Function: GTPase activator activity; protein binding; Rho GDP-dissociation inhibitor activity

Biological Process: cell motility; negative regulation of apoptosis; negative regulation of axonogenesis; negative regulation of cell adhesion; nerve growth factor receptor signaling pathway; positive regulation of axonogenesis; positive regulation of GTPase activity; regulation of axonogenesis; regulation of catalytic activity; regulation of small GTPase mediated signal transduction; Rho protein signal transduction; small GTPase mediated signal transduction

Disease: Nephrotic Syndrome, Type 8