Cysteine-rich secretory protein 1 (Crisp1) Recombinant Protein | Crisp1 recombinant protein
Recombinant Rat Cysteine-rich secretory protein 1 (Crisp1)
Gene Names
Crisp3; Aeg; Crisp1; Crisp-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cysteine-rich secretory protein 1 (Crisp1); Recombinant Rat Cysteine-rich secretory protein 1 (Crisp1); Crisp1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-246, Full length protein
Sequence
QDTTDEWDRDLENLSTTKLSVQEEIINKHNQLRRTVSPSGSDLLRVEWDHDAYVNAQKWANRCIYNHSPLQHRTTTLKCGENLFMANYPASWSSVIQDWYDESLDFVFGFGPKKVGVKVGHYTQVVWNSTFLVACGVAECPDQPLKYFYVCHYCPGGNYVGRLYSPYTEGEPCDSCPGNCEDGLCTNSCEYEDNYSNCGDLKKMVSCDDPLLKEGCRASCFCEDKIH
Sequence Length
227
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Crisp1 recombinant protein
Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. This protein is a member of the cysteine-rich secretory protein (CRISP) family. This protein is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface. Two isoforms are encoded by transcript variants of this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,847 Da
NCBI Official Full Name
cysteine-rich secretory protein 1
NCBI Official Synonym Full Names
cysteine-rich secretory protein 3
NCBI Official Symbol
Crisp3
NCBI Official Synonym Symbols
Aeg; Crisp1; Crisp-1
NCBI Protein Information
cysteine-rich secretory protein 1
UniProt Protein Name
Cysteine-rich secretory protein 1
Protein Family
UniProt Gene Name
Crisp1
UniProt Synonym Gene Names
Aeg; Protein D; Protein E; SCP
Uniprot Description
This protein is supposed to help spermatozoa undergo functional maturation while they move from the testis to the ductus deferens.
Research Articles on Crisp1
Similar Products
Product Notes
The Crisp1 crisp1 (Catalog #AAA955939) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-246, Full length protein. The amino acid sequence is listed below: QDTTDEWDRD LENLSTTKLS VQEEIINKHN QLRRTVSPSG SDLLRVEWDH DAYVNAQKWA NRCIYNHSPL QHRTTTLKCG ENLFMANYPA SWSSVIQDWY DESLDFVFGF GPKKVGVKVG HYTQVVWNST FLVACGVAEC PDQPLKYFYV CHYCPGGNYV GRLYSPYTEG EPCDSCPGNC EDGLCTNSCE YEDNYSNCGD LKKMVSCDDP LLKEGCRASC FCEDKIH. It is sometimes possible for the material contained within the vial of "Cysteine-rich secretory protein 1 (Crisp1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
