Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CRISP1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

Rabbit CRISP1 Polyclonal Antibody | anti-CRISP1 antibody

CRISP1 antibody - N-terminal region

Gene Names
CRISP1; ARP; AEGL1; HUMARP; CRISP-1; HEL-S-57; HSCRISP1D; HSCRISP1G
Reactivity
Cow, Dog, Goat, Human, Pig, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CRISP1; Polyclonal Antibody; CRISP1 antibody - N-terminal region; anti-CRISP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Human, Pig, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW
Sequence Length
249
Applicable Applications for anti-CRISP1 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 85%; Goat: 85%; Human: 100%; Pig: 85%; Rabbit: 79%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CRISP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CRISP1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

Western Blot (WB) (WB Suggested Anti-CRISP1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Related Product Information for anti-CRISP1 antibody
This is a rabbit polyclonal antibody against CRISP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. CRISP1 is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface.Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. The protein encoded by this gene is a member of the cysteine-rich secretory protein (CRISP) family. This protein is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface. Two isoforms are encoded by transcript variants of this gene.
Product Categories/Family for anti-CRISP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
167
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
cysteine-rich secretory protein 1 isoform 1
NCBI Official Synonym Full Names
cysteine rich secretory protein 1
NCBI Official Symbol
CRISP1
NCBI Official Synonym Symbols
ARP; AEGL1; HUMARP; CRISP-1; HEL-S-57; HSCRISP1D; HSCRISP1G
NCBI Protein Information
cysteine-rich secretory protein 1
UniProt Protein Name
Cysteine-rich secretory protein 1
UniProt Gene Name
CRISP1
UniProt Synonym Gene Names
AEGL1; CRISP-1
UniProt Entry Name
CRIS1_HUMAN

NCBI Description

Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. The protein encoded by this gene is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head, where it plays a role in sperm-egg fusion. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]

Uniprot Description

CRISP1: May have a role in sperm-egg fusion and maturation. Belongs to the CRISP family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: extracellular space; nucleus

Molecular Function: calcium channel regulator activity

Biological Process: fusion of sperm to egg plasma membrane; binding of sperm to zona pellucida; regulation of acrosome reaction

Research Articles on CRISP1

Similar Products

Product Notes

The CRISP1 crisp1 (Catalog #AAA3211384) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRISP1 antibody - N-terminal region reacts with Cow, Dog, Goat, Human, Pig, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CRISP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CRISP1 crisp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKMSWSEEAA QNARIFSKYC DMTESNPLER RLPNTFCGEN MHMTSYPVSW. It is sometimes possible for the material contained within the vial of "CRISP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.