Cadherin, Epithelial (CDHE) Recombinant Protein | CDHE recombinant protein
Recombinant Cadherin, Epithelial (CDHE)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-DNAPIFN PSTYQGQVLE NEVGARIATL KVTDDDAPNT PAWNAVYTVV NDPDHQFTVI TDPKTNEGIL KTAKGLDFEA KQQYILHVTV ENEEPFEGSL VPSTATVTVD VVDVNEAPIF VPAEKRVEVP EDFGVGLEIA SYTAREPDTF MEQKITYRIW RDTANWLEIN PETGVISTRA EMDREDSEHV KNSTYTALII ATDDGSPIAT GTGTLLLVLS DVNDNAPIPE PRNMQFCQRN PKPHVITILD PDLPPNTS
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.
NCBI and Uniprot Product Information
NCBI Description
cell-cell adhesion molecule; may play a role in axonal growth and synase formation [RGD, Feb 2006]
Uniprot Description
CDH1: a single-pass type I membrane protein, and calcium dependent cell adhesion proteins. It is a ligand for integrin alpha-E/beta-7, and it colocalizes with DLG7 at sites of cell-cell contact in intestinal epithelial cells. Anchored to actin microfilaments through association with alpha-, beta- and gamma-catenin. Sequential proteolysis induced by apoptosis or calcium influx, results in translocation from sites of cell-cell contact to the cytoplasm. Involved in mechanisms regulating cell-cell adhesions, mobility and proliferation of epithelial cells. Defects in CDH1 are involved in dysfunction of the cell-cell adhesion system, triggering cancer invasion (gastric, breast, ovary, endometrium and thyroid) and metastasis. Has a potent invasive suppressor role.
Protein type: Membrane protein, integral; Cell adhesion; Motility/polarity/chemotaxis; Ubiquitin ligase
Cellular Component: apical junction complex; internal side of plasma membrane; cell surface; focal adhesion; basolateral plasma membrane; lateral loop; integral to membrane; intercellular junction; trans-Golgi network; catenin complex; actin cytoskeleton; cell-cell adherens junction; adherens junction; axon; apical part of cell; perinuclear region of cytoplasm; cytoplasm; plasma membrane; nerve terminal; cell junction; lateral plasma membrane; endosome
Molecular Function: protein domain specific binding; protein binding; gamma-catenin binding; beta-catenin binding; GTPase activating protein binding; cell adhesion molecule binding; ankyrin binding; calcium ion binding; glycoprotein binding; protein phosphatase binding
Biological Process: response to drug; in utero embryonic development; positive regulation of transcription, DNA-dependent; response to toxin; regulation of caspase activity; trophectodermal cell differentiation; response to organic substance; regulation of water loss via skin; cell-cell adhesion; synaptogenesis; regulation of protein localization; sensory perception of sound; pituitary gland development; calcium-dependent cell-cell adhesion; protein metabolic process; positive regulation of transcription factor import into nucleus; negative regulation of cell-cell adhesion; homophilic cell adhesion; protein homooligomerization; neurite development; negative regulation of epithelial cell proliferation
Research Articles on CDHE
Similar Products
Product Notes
The CDHE cdh1 (Catalog #AAA2009265) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Cadherin, Epithelial (CDHE) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the CDHE cdh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-DNAPIFN PSTYQGQVLE NEVGARIATL KVTDDDAPNT PAWNAVYTVV NDPDHQFTVI TDPKTNEGIL KTAKGLDFEA KQQYILHVTV ENEEPFEGSL VPSTATVTVD VVDVNEAPIF VPAEKRVEVP EDFGVGLEIA SYTAREPDTF MEQKITYRIW RDTANWLEIN PETGVISTRA EMDREDSEHV KNSTYTALII ATDDGSPIAT GTGTLLLVLS DVNDNAPIPE PRNMQFCQRN PKPHVITILD PDLPPNTS. It is sometimes possible for the material contained within the vial of "Cadherin, Epithelial (CDHE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.