Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human ZP2 Monoclonal Antibody | anti-ZP2 antibody

ZP2 (Zona Pellucida Glycoprotein 2, Zona Pellucida Sperm-binding Protein 2, Zp-2, Zona Pellucida Protein A, ZPA) (AP)

Gene Names
ZP2; ZPA; Zp-2; OOMD6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZP2; Monoclonal Antibody; ZP2 (Zona Pellucida Glycoprotein 2; Zona Pellucida Sperm-binding Protein 2; Zp-2; Zona Pellucida Protein A; ZPA) (AP); anti-ZP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B9
Specificity
Recognizes human ZP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
745
Applicable Applications for anti-ZP2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa400-510 from human ZP2 (NP_003451) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NSSCQPVFEAQSQGLVRFHIPLNGCGTRYKFEDDKVVYENEIHALWTDFPPSKISRDSEFRMTVKCSYSRNDMLLNINVESLTPPVASVKLGPFTLILQSYPDNSYQQPY*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Testing Data

(Detection limit for recombinant GST tagged ZP2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZP2 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-ZP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
zona pellucida sperm-binding protein 2 isoform 1 preproprotein
NCBI Official Synonym Full Names
zona pellucida glycoprotein 2
NCBI Official Symbol
ZP2
NCBI Official Synonym Symbols
ZPA; Zp-2; OOMD6
NCBI Protein Information
zona pellucida sperm-binding protein 2
UniProt Protein Name
Zona pellucida sperm-binding protein 2
UniProt Gene Name
ZP2
UniProt Synonym Gene Names
ZPA; Zp-2
UniProt Entry Name
ZP2_HUMAN

NCBI Description

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed of three glycoproteins with various functions during fertilization and preimplantation development. The glycosylated mature peptide is one of the structural components of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. Female mice lacking this gene do not form a stable zona matrix and are sterile. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Uniprot Description

ZP2: The mammalian zona pellucida, which mediates species- specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP2 may act as a secondary sperm receptor. Belongs to the ZP domain family. ZPA subfamily.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 16p12

Cellular Component: endoplasmic reticulum; extracellular matrix; extracellular region; Golgi apparatus; integral to membrane; multivesicular body; plasma membrane; proteinaceous extracellular matrix; secretory granule

Molecular Function: acrosin binding; coreceptor activity

Biological Process: binding of sperm to zona pellucida; intracellular protein transport; manganese ion transport; regulation of acrosome reaction; signal transduction

Research Articles on ZP2

Similar Products

Product Notes

The ZP2 zp2 (Catalog #AAA6134708) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZP2 (Zona Pellucida Glycoprotein 2, Zona Pellucida Sperm-binding Protein 2, Zp-2, Zona Pellucida Protein A, ZPA) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZP2 zp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.