C-C motif chemokine 20 (Ccl20) Recombinant Protein | Ccl20 recombinant protein

Recombinant Rat C-C motif chemokine 20 (Ccl20)

Cat. Num. AAA956196

• Gene Names: Ccl20; ST38; Scya20
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-C motif chemokine 20 (Ccl20); Recombinant Rat C-C motif chemokine 20 (Ccl20); Ccl20 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 27-96, Full length protein
• Sequence: SNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM
• Sequence Length: 70

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 9507069
• NCBI GeneID: 29538
• NCBI Accession #: NP_062106.1
• NCBI GenBank Nucleotide #: NM_019233.1
• UniProt Accession #: P97884
• Molecular Weight: 10,875 Da
• NCBI Official Full Name: C-C motif chemokine 20
• NCBI Official Synonym Full Names: C-C motif chemokine ligand 20
• NCBI Official Symbol: Ccl20
• NCBI Official Synonym Symbols: ST38; Scya20
• NCBI Protein Information: C-C motif chemokine 20
• UniProt Protein Name: C-C motif chemokine 20
• Protein Family: C-C motif chemokine
• UniProt Gene Name: Ccl20
• UniProt Synonym Gene Names: Scya20; St38; MIP-3-alpha

NCBI Description

chemokine upregulated in ischemic brain tissue [RGD, Feb 2006]

Uniprot Description

Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions. The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and autoimmune diseases. CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Involved in the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells. Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells.