V-type proton ATPase subunit G 1 (ATP6V1G1) Recombinant Protein | ATP6V1G1 recombinant protein
Recombinant Dog V-type proton ATPase subunit G 1 (ATP6V1G1)
Gene Names
ATP6V1G2; ATP6G; ATP6V1G1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
V-type proton ATPase subunit G 1 (ATP6V1G1); Recombinant Dog V-type proton ATPase subunit G 1 (ATP6V1G1); ATP6V1G1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-118, Full length protein
Sequence
ASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVELYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRIAV
Sequence Length
117
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ATP6V1G1 recombinant protein
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This protein is one of three V1 domain G subunit proteins. Pseudogenes of this gene have been characterized.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,592 Da
NCBI Official Full Name
V-type proton ATPase subunit G 1
NCBI Official Synonym Full Names
ATPase H+ transporting V1 subunit G2
NCBI Official Symbol
ATP6V1G2
NCBI Official Synonym Symbols
ATP6G; ATP6V1G1
NCBI Protein Information
V-type proton ATPase subunit G 1
UniProt Protein Name
V-type proton ATPase subunit G 1
Protein Family
UniProt Gene Name
ATP6V1G1
UniProt Synonym Gene Names
ATP6G; V-ATPase subunit G 1
Uniprot Description
Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Similar Products
Product Notes
The ATP6V1G1 atp6v1g1 (Catalog #AAA1445844) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-118, Full length protein. The amino acid sequence is listed below: ASQSQGIQQL LQAEKRAAEK VADARKRKAR RLKQAKEEAQ MEVELYRRER EQEFQSKQQA AMGSQGNLSA EVEQATRRQV QGMQSSQQRN RERVLAQLLG MVCDVRPQVH PNYRIAV. It is sometimes possible for the material contained within the vial of "V-type proton ATPase subunit G 1 (ATP6V1G1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
