Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Guanylate cyclase activator 2B Recombinant Protein | GUCA2B recombinant protein

Recombinant Human Guanylate cyclase activator 2B

Gene Names
GUCA2B; UGN; GCAP-II
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Guanylate cyclase activator 2B; Recombinant Human Guanylate cyclase activator 2B; Guanylate cyclase C-activating peptide II; GCAP-II; Uroguanylin; UGN; GUCA2B recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-112aa; Full Length
Sequence
VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
Sequence Length
112
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for GUCA2B recombinant protein
Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
Product Categories/Family for GUCA2B recombinant protein
References
Cloning and characterization of a cDNA encoding a precursor for human uroguanylin.Miyazato M., Nakazato M., Yamaguchi H., Date Y., Kojima M., Kangawa K., Matsuo H., Matsukura S.Biochem. Biophys. Res. Commun. 219:644-648(1996) A new human guanylate cyclase-activating peptide (GCAP-II, uroguanylin)precursor cDNA and colonic expression.Hill O., Cetin Y., Cieslak A., Maegert H.-J., Forssmann W.-G.Biochim. Biophys. Acta 1253:146-149(1995) Structure of the human uroguanylin / GCAP-II gene and expression within the gastrointestinal tract.Maegert H.-J., Hill O., Forssmann W.-G. Genomic structure and chromosomal localization of human uroguanylin.Miyazato M., Nakazato M., Matsukura S., Kangawa K., Matsuo H.Genomics 43:359-365(1997) One peptide, two topologies structure and interconversion dynamics of human uroguanylin isomers.Marx U.C., Klodt J., Meyer M., Gerlach H., Roesch P., Forssmann W.-G., Adermann K.J. Pept. Res. 52:229-240(1998)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.5 kDa
NCBI Official Full Name
guanylate cyclase activator 2B preproprotein
NCBI Official Synonym Full Names
guanylate cyclase activator 2B
NCBI Official Symbol
GUCA2B
NCBI Official Synonym Symbols
UGN; GCAP-II
NCBI Protein Information
guanylate cyclase activator 2B
UniProt Protein Name
Guanylate cyclase activator 2B
UniProt Gene Name
GUCA2B
UniProt Synonym Gene Names
GCAP-II; UGN
UniProt Entry Name
GUC2B_HUMAN

NCBI Description

This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products, including uroguanylin, a member of the guanylin family of peptides and an endogenous ligand of the guanylate cyclase-C receptor. Binding of this peptide to its cognate receptor stimulates an increase in cyclic GMP and may regulate salt and water homeostasis in the intestine and kidneys. [provided by RefSeq, Nov 2015]

Uniprot Description

GUCA2B: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport. Belongs to the guanylin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1p34-p33

Cellular Component: photoreceptor outer segment

Molecular Function: calcium sensitive guanylate cyclase activator activity

Biological Process: body fluid secretion; cGMP biosynthetic process; excretion; negative regulation of blood pressure; positive regulation of guanylate cyclase activity

Research Articles on GUCA2B

Similar Products

Product Notes

The GUCA2B guca2b (Catalog #AAA969714) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-112aa; Full Length. The amino acid sequence is listed below: VYIQYQGFRV QLESMKKLSD LEAQWAPSPR LQAQSLLPAV CHHPALPQDL QPVCASQEAS SIFKTLRTIA NDDCELCVNV ACTGCL. It is sometimes possible for the material contained within the vial of "Guanylate cyclase activator 2B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.