Methylosome subunit pICln (CLNS1A) Recombinant Protein | CLNS1A recombinant protein

Recombinant Human Methylosome subunit pICln (CLNS1A)

Cat. Num. AAA968610

• Gene Names: CLNS1A; CLCI; ICln; CLNS1B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Methylosome subunit pICln (CLNS1A); Recombinant Human Methylosome subunit pICln (CLNS1A); CLNS1A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-237, Full length protein
• Sequence: SFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
• Sequence Length: 236

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for CLNS1A recombinant protein

This gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerous cytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoprotein biosynthesis, platelet activation and cytoskeletal organization. The protein is also found associated with the plasma membrane where it functions as a chloride current regulator. Pseudogenes of this gene are found on chromosomes 1, 4 and 6.

NCBI and Uniprot Product Information

• NCBI GI #: 4502891
• NCBI GeneID: 1207
• NCBI Accession #: NP_001284.1
• NCBI GenBank Nucleotide #: NM_001293.2
• UniProt Accession #: P54105; Q0VDK6; Q9NRD2; Q9NRD3; B2RCS9
• Molecular Weight: 26,215 Da
• NCBI Official Full Name: methylosome subunit pICln isoform a
• NCBI Official Synonym Full Names: chloride nucleotide-sensitive channel 1A
• NCBI Official Symbol: CLNS1A
• NCBI Official Synonym Symbols: CLCI; ICln; CLNS1B
• NCBI Protein Information: methylosome subunit pICln
• UniProt Protein Name: Methylosome subunit pICln
• UniProt Gene Name: CLNS1A
• UniProt Synonym Gene Names: CLCI; ICLN; I(Cln); ClCI

NCBI Description

This gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerous cytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoprotein biosynthesis, platelet activation and cytoskeletal organization. The protein is also found associated with the plasma membrane where it functions as a chloride current regulator. Pseudogenes of this gene are found on chromosomes 1, 4 and 6. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]

Uniprot Description

Chaperone that regulates the assembly of spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus. May also indirectly participate in cellular volume control by activation of a swelling-induced chloride conductance pathway.