Rabbit CLNS1A Polyclonal Antibody | anti-CLNS1A antibody

CLNS1A Polyclonal Antibody

Cat. Num. AAA9140684

• Gene Names: CLNS1A; CLCI; ICln; CLNS1B
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purification
• Synonyms: CLNS1A; Polyclonal Antibody; CLNS1A Polyclonal Antibody; CLCI; CLNS1B; ICln; methylosome subunit pICln; anti-CLNS1A antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 1.51 mg/ml (varies by lot)
• Sequence Length: 237

• Applicable Applications for anti-CLNS1A antibody: Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: WB: 1:500-1:2000; IHC: 1:50-1:100; IF: 1:50-1:100
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-237 of human CLNS1A (NP_001284.1).
• Immunogen Sequence: MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
• Positive Samples: HT-29, 293T, DU145, Jurkat, HeLa, Mouse Brain
• Cellular Location: Cytoplasm, Nucleus, Cytoskeleton, Cytosol
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-CLNS1A Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-CLNS1A Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-CLNS1A Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-CLNS1A Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-CLNS1A Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-CLNS1A Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-CLNS1A Polyclonal Antibody)

Related Product Information for anti-CLNS1A antibody

This gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerous cytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoprotein biosynthesis, platelet activation and cytoskeletal organization. The protein is also found associated with the plasma membrane where it functions as a chloride current regulator. Pseudogenes of this gene are found on chromosomes 1, 4 and 6. Several transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 4502891
• NCBI GeneID: 1207
• NCBI Accession #: NP_001284.1
• NCBI GenBank Nucleotide #: NP_001284.1
• UniProt Accession #: P54105
• Molecular Weight: Calculated: 26kDa; Observed: 38kDa
• NCBI Official Full Name: methylosome subunit pICln isoform a
• NCBI Official Synonym Full Names: chloride nucleotide-sensitive channel 1A
• NCBI Official Symbol: CLNS1A
• NCBI Official Synonym Symbols: CLCI; ICln; CLNS1B
• NCBI Protein Information: methylosome subunit pICln
• UniProt Protein Name: Methylosome subunit pICln
• UniProt Gene Name: CLNS1A
• UniProt Synonym Gene Names: CLCI; ICLN; I(Cln); ClCI
• UniProt Entry Name: ICLN_HUMAN

NCBI Description

This gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerous cytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoprotein biosynthesis, platelet activation and cytoskeletal organization. The protein is also found associated with the plasma membrane where it functions as a chloride current regulator. Pseudogenes of this gene are found on chromosomes 1, 4 and 6. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]

Uniprot Description

ICLN: The interaction with Sm proteins inhibits their assembly on U RNA and interferes with snRNP biogenesis. Inhibits the binding of survival motor neuron protein (SMN) to Sm proteins. May participate in cellular volume control by activation of a swelling-induced chloride conductance pathway. Belongs to the pICln (TC 1.A.47) family.

Protein type: Channel, chloride

Chromosomal Location of Human Ortholog: 11q13.5-q14

Cellular Component: nucleoplasm; cytoskeleton; cytoplasm; plasma membrane; cytosol; nucleus

Molecular Function: protein binding

Biological Process: spliceosomal snRNP biogenesis; gene expression; chloride transport; cell volume homeostasis