Mouse anti-Human CASP10 Monoclonal Antibody | anti-CASP10 antibody

CASP10 (Caspase-10, CASP-10, ICE-like Apoptotic Protease 4, Apoptotic Protease Mch-4, FAS-associated Death Domain Protein Interleukin-1B-converting Enzyme 2, FLICE2, Caspase-10 Subunit p23/17, Caspase-10 Subunit p12, MCH4) (AP)

Cat. Num. AAA6130368

• Gene Names: CASP10; MCH4; ALPS2; FLICE2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CASP10; Monoclonal Antibody; CASP10 (Caspase-10; CASP-10; ICE-like Apoptotic Protease 4; Apoptotic Protease Mch-4; FAS-associated Death Domain Protein Interleukin-1B-converting Enzyme 2; FLICE2; Caspase-10 Subunit p23/17; Caspase-10 Subunit p12; MCH4) (AP); anti-CASP10 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E7
• Specificity: Recognizes human CASP10.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 521

• Applicable Applications for anti-CASP10 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-110 from human CASP10 (NP_116756) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQ
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(CASP10 monoclonal antibody. Western Blot analysis of CASP10 expression in U-2 OS.)

Testing Data

(Detection limit for recombinant GST tagged CASP10 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-CASP10 antibody

Caspases are death effector domain-containing cysteine aspartases presumed to be at or near the apex of apoptotic signaling pathways. All known isoforms of Caspase-10 are abundantly expressed in fetal lung, kidney, and skeletal muscle but are very poorly expressed or absent in these tissues in the adult, implying a possible role for the Caspase-10 family in fetal development.

Product Categories/Family for anti-CASP10 antibody

Antibodies; Apoptosis; Caspase

NCBI and Uniprot Product Information

• NCBI GI #: 47078269
• NCBI GeneID: 843
• NCBI Accession #: NP_116756
• NCBI GenBank Nucleotide #: NM_032974
• UniProt Accession #: Q92851
• NCBI Official Full Name: caspase-10 isoform 2 preproprotein
• NCBI Official Synonym Full Names: caspase 10
• NCBI Official Symbol: CASP10
• NCBI Official Synonym Symbols: MCH4; ALPS2; FLICE2
• NCBI Protein Information: caspase-10
• UniProt Protein Name: Caspase-10
• Protein Family: Caspase
• UniProt Gene Name: CASP10
• UniProt Synonym Gene Names: MCH4; CASP-10; FLICE2
• UniProt Entry Name: CASPA_HUMAN

NCBI Description

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 3 and 7, and the protein itself is processed by caspase 8. Mutations in this gene are associated with type IIA autoimmune lymphoproliferative syndrome, non-Hodgkin lymphoma and gastric cancer. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Apr 2011]

Uniprot Description

CASP10: Involved in the activation cascade of caspases responsible for apoptosis execution. Recruited to both Fas- and TNFR-1 receptors in a FADD dependent manner. May participate in the granzyme B apoptotic pathways. Cleaves and activates caspase- 3, -4, -6, -7, -8, and -9. Hydrolyzes the small- molecule substrates, Tyr-Val-Ala-Asp-|-AMC and Asp-Glu-Val-Asp-|-AMC. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 23/17 kDa (p23/17) (depending on the splicing events) and a 12 kDa (p12) subunit. Self-associates. Interacts with FADD and CASP8. Found in a Fas signaling complex consisting of FAS, FADD, CASP8 and CASP10. Detectable in most tissues. Lowest expression is seen in brain, kidney, prostate, testis and colon. Belongs to the peptidase C14A family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.22.63

Chromosomal Location of Human Ortholog: 2q33-q34

Cellular Component: cytoplasm; plasma membrane; CD95 death-inducing signaling complex; cytosol

Molecular Function: protein binding; cysteine-type endopeptidase activity; ubiquitin protein ligase binding

Biological Process: regulation of apoptosis; positive regulation of I-kappaB kinase/NF-kappaB cascade; apoptosis; innate immune response; proteolysis

Disease: Lymphoma, Non-hodgkin, Familial; Gastric Cancer; Autoimmune Lymphoproliferative Syndrome, Type Iia