Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human CASP10 Monoclonal Antibody | anti-CASP10 antibody

CASP10 (Caspase-10, CASP-10, ICE-like Apoptotic Protease 4, Apoptotic Protease Mch-4, FAS-associated Death Domain Protein Interleukin-1B-converting Enzyme 2, FLICE2, Caspase-10 Subunit p23/17, Caspase-10 Subunit p12, MCH4) (HRP)

Gene Names
CASP10; MCH4; ALPS2; FLICE2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CASP10; Monoclonal Antibody; CASP10 (Caspase-10; CASP-10; ICE-like Apoptotic Protease 4; Apoptotic Protease Mch-4; FAS-associated Death Domain Protein Interleukin-1B-converting Enzyme 2; FLICE2; Caspase-10 Subunit p23/17; Caspase-10 Subunit p12; MCH4) (HRP); anti-CASP10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E7
Specificity
Recognizes human CASP10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
521
Applicable Applications for anti-CASP10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human CASP10 (NP_116756) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQ
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(CASP10 monoclonal antibody. Western Blot analysis of CASP10 expression in U-2 OS.)

Western Blot (WB) (CASP10 monoclonal antibody. Western Blot analysis of CASP10 expression in U-2 OS.)

Testing Data

(Detection limit for recombinant GST tagged CASP10 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CASP10 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-CASP10 antibody
Caspases are death effector domain-containing cysteine aspartases presumed to be at or near the apex of apoptotic signaling pathways. All known isoforms of Caspase-10 are abundantly expressed in fetal lung, kidney, and skeletal muscle but are very poorly expressed or absent in these tissues in the adult, implying a possible role for the Caspase-10 family in fetal development.
Product Categories/Family for anti-CASP10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
843
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
caspase-10 isoform 2 preproprotein
NCBI Official Synonym Full Names
caspase 10
NCBI Official Symbol
CASP10
NCBI Official Synonym Symbols
MCH4; ALPS2; FLICE2
NCBI Protein Information
caspase-10
UniProt Protein Name
Caspase-10
Protein Family
UniProt Gene Name
CASP10
UniProt Synonym Gene Names
MCH4; CASP-10; FLICE2
UniProt Entry Name
CASPA_HUMAN

NCBI Description

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 3 and 7, and the protein itself is processed by caspase 8. Mutations in this gene are associated with type IIA autoimmune lymphoproliferative syndrome, non-Hodgkin lymphoma and gastric cancer. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Apr 2011]

Uniprot Description

CASP10: Involved in the activation cascade of caspases responsible for apoptosis execution. Recruited to both Fas- and TNFR-1 receptors in a FADD dependent manner. May participate in the granzyme B apoptotic pathways. Cleaves and activates caspase- 3, -4, -6, -7, -8, and -9. Hydrolyzes the small- molecule substrates, Tyr-Val-Ala-Asp-|-AMC and Asp-Glu-Val-Asp-|-AMC. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 23/17 kDa (p23/17) (depending on the splicing events) and a 12 kDa (p12) subunit. Self-associates. Interacts with FADD and CASP8. Found in a Fas signaling complex consisting of FAS, FADD, CASP8 and CASP10. Detectable in most tissues. Lowest expression is seen in brain, kidney, prostate, testis and colon. Belongs to the peptidase C14A family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.22.63

Chromosomal Location of Human Ortholog: 2q33-q34

Cellular Component: cytoplasm; plasma membrane; CD95 death-inducing signaling complex; cytosol

Molecular Function: protein binding; cysteine-type endopeptidase activity; ubiquitin protein ligase binding

Biological Process: regulation of apoptosis; positive regulation of I-kappaB kinase/NF-kappaB cascade; apoptosis; innate immune response; proteolysis

Disease: Lymphoma, Non-hodgkin, Familial; Gastric Cancer; Autoimmune Lymphoproliferative Syndrome, Type Iia

Research Articles on CASP10

Similar Products

Product Notes

The CASP10 casp10 (Catalog #AAA6151580) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CASP10 (Caspase-10, CASP-10, ICE-like Apoptotic Protease 4, Apoptotic Protease Mch-4, FAS-associated Death Domain Protein Interleukin-1B-converting Enzyme 2, FLICE2, Caspase-10 Subunit p23/17, Caspase-10 Subunit p12, MCH4) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CASP10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CASP10 casp10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CASP10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.