ASAP3 blocking peptide
ASAP3 Peptide - middle region
Gene Names
ASAP3; ACAP4; UPLC1; CENTB6; DDEFL1
Reactivity
Human
Synonyms
ASAP3; ASAP3 Peptide - middle region; ASAP3 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: FGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLT
Sequence Length
1006
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ASAP3 blocking peptide
This is a synthetic peptide designed for use in combination with anti- ASAP3 Antibody, made
Target Description: This gene encodes a member of a subfamily of ADP-ribosylation factor(Arf) GTPase-activating proteins that contain additional ankyrin repeat and pleckstrin homology domains. The Arf GAP domain of this protein catalyzes the hydrolysis of GTP bound to Arf proteins. The encoded protein promotes cell differentiation and migration and has been implicated in cancer cell invasion. Alternative splicing results in multiple transcript variants.
Target Description: This gene encodes a member of a subfamily of ADP-ribosylation factor(Arf) GTPase-activating proteins that contain additional ankyrin repeat and pleckstrin homology domains. The Arf GAP domain of this protein catalyzes the hydrolysis of GTP bound to Arf proteins. The encoded protein promotes cell differentiation and migration and has been implicated in cancer cell invasion. Alternative splicing results in multiple transcript variants.
Product Categories/Family for ASAP3 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
110 kDa
NCBI Official Synonym Full Names
ArfGAP with SH3 domain, ankyrin repeat and PH domain 3
NCBI Official Symbol
ASAP3
NCBI Official Synonym Symbols
ACAP4; UPLC1; CENTB6; DDEFL1
NCBI Protein Information
arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3
UniProt Protein Name
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2
UniProt Gene Name
ASAP2
UniProt Synonym Gene Names
DDEF2; KIAA0400; PAG3; PAP
UniProt Entry Name
ASAP2_HUMAN
NCBI Description
This gene encodes a member of a subfamily of ADP-ribosylation factor(Arf) GTPase-activating proteins that contain additional ankyrin repeat and pleckstrin homology domains. The Arf GAP domain of this protein catalyzes the hydrolysis of GTP bound to Arf proteins. The encoded protein promotes cell differentiation and migration and has been implicated in cancer cell invasion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2009]
Research Articles on ASAP3
Similar Products
Product Notes
The ASAP3 asap2 (Catalog #AAA3247427) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ASAP3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGTEKVGFLY KKSDGIRRVW QKRKCGVKYG CLTISHSTIN RPPVKLTLLT. It is sometimes possible for the material contained within the vial of "ASAP3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
