CLP1 blocking peptide

CLP1 Peptide - N-terminal region

Cat. Num. AAA3241231

• Gene Names: CLP1; HEAB; hClp1
• Reactivity: Human
• Applications: Western Blot
• Synonyms: CLP1; CLP1 Peptide - N-terminal region; CLP1 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: MRRQAEKEEERGPRVMVVGPTDVGKSTVCRLLLNYAITSRLADVFNQRCE
• Sequence Length: 361

• Applicable Applications for CLP1 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for CLP1 blocking peptide

This is a synthetic peptide designed for use in combination with anti-CLP1 Antibody, made

Target Description: CLP1 is a polynucleotide kinase that can phosphorylate the 5'-hydroxyl groups of double-stranded RNA (dsRNA), single-stranded RNA (ssRNA), double stranded DNA (dsDNA) and double-stranded DNA:RNA hybrids.

Product Categories/Family for CLP1 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 217272859
• NCBI GeneID: 10978
• NCBI Accession #: NP_001136069
• NCBI GenBank Nucleotide #: NM_001142597
• UniProt Accession #: Q92989
• Molecular Weight: 41kDa
• NCBI Official Full Name: polyribonucleotide 5'-hydroxyl-kinase Clp1 isoform 2
• NCBI Official Synonym Full Names: cleavage and polyadenylation factor I subunit 1
• NCBI Official Symbol: CLP1
• NCBI Official Synonym Symbols: HEAB; hClp1
• NCBI Protein Information: polyribonucleotide 5'-hydroxyl-kinase Clp1
• UniProt Protein Name: Polyribonucleotide 5'-hydroxyl-kinase Clp1
• Protein Family: Tyrosine-protein phosphatase
• UniProt Gene Name: CLP1

NCBI Description

This gene encodes a member of the Clp1 family. The encoded protein is a multifunctional kinase which is a component of the tRNA splicing endonuclease complex and a component of the pre-mRNA cleavage complex II. This protein is implicated in tRNA, mRNA, and siRNA maturation. Mutations in this gene are associated with pontocerebellar hypoplasia type 10 (PCH10). Alternatively splice transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]

Uniprot Description

Polynucleotide kinase that can phosphorylate the 5'-hydroxyl groups of double-stranded RNA (dsRNA), single-stranded RNA (ssRNA), double-stranded DNA (dsDNA) and double-stranded DNA:RNA hybrids. dsRNA is phosphorylated more efficiently than dsDNA, and the RNA component of a DNA:RNA hybrid is phosphorylated more efficiently than the DNA component. Plays a key role in both tRNA splicing and mRNA 3'-end formation. Component of the tRNA splicing endonuclease complex: phosphorylates the 5'-terminus of the tRNA 3'-exon during tRNA splicing; this phosphorylation event is a prerequisite for the subsequent ligation of the two exon halves and the production of a mature tRNA (PubMed:24766809, PubMed:24766810). Its role in tRNA splicing and maturation is required for cerebellar development (PubMed:24766809, PubMed:24766810). Component of the pre-mRNA cleavage complex II (CF-II), which seems to be required for mRNA 3'-end formation. Also phosphorylates the 5'-terminus of exogenously introduced short interfering RNAs (siRNAs), which is a necessary prerequisite for their incorporation into the RNA-induced silencing complex (RISC). However, endogenous siRNAs and microRNAs (miRNAs) that are produced by the cleavage of dsRNA precursors by DICER1 already contain a 5'-phosphate group, so this protein may be dispensible for normal RNA-mediated gene silencing.