Western Blot (WB)
(WB Suggested Anti-UBE2O Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: RPMI 8226 cell lysateUBE2O is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Rabbit UBE2O Polyclonal Antibody | anti-UBE2O antibody
UBE2O antibody - middle region
Gene Names
UBE2O; E2-230K
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UBE2O; Polyclonal Antibody; UBE2O antibody - middle region; anti-UBE2O antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR
Sequence Length
1292
Applicable Applications for anti-UBE2O antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UBE2O
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-UBE2O Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: RPMI 8226 cell lysateUBE2O is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Western Blot (WB)
(WB Suggested Anti-UBE2O Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: RPMI 8226 cell lysateUBE2O is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Related Product Information for anti-UBE2O antibody
This is a rabbit polyclonal antibody against UBE2O. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: UBE2O catalyzes the covalent attachment of ubiquitin to other proteins.
Target Description: UBE2O catalyzes the covalent attachment of ubiquitin to other proteins.
Product Categories/Family for anti-UBE2O antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
141kDa
NCBI Official Full Name
(E3-independent) E2 ubiquitin-conjugating enzyme
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 O
NCBI Official Symbol
UBE2O
NCBI Official Synonym Symbols
E2-230K
NCBI Protein Information
(E3-independent) E2 ubiquitin-conjugating enzyme
UniProt Protein Name
E2/E3 hybrid ubiquitin-protein ligase UBE2O
Protein Family
UniProt Gene Name
UBE2O
UniProt Synonym Gene Names
KIAA1734; Ubiquitin-conjugating enzyme E2-230K
UniProt Entry Name
UBE2O_HUMAN
Uniprot Description
UBE2O: Catalyzes the covalent attachment of ubiquitin to other proteins. Belongs to the ubiquitin-conjugating enzyme family.
Protein type: EC 6.3.2.19; Ubiquitin conjugating system; Ubiquitin ligase; Ligase
Chromosomal Location of Human Ortholog: 17q25.1
Cellular Component: nucleoplasm; cytoplasm; nucleus
Molecular Function: protein binding; small conjugating protein ligase activity; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; ATP binding; ligase activity
Biological Process: protein monoubiquitination; retrograde transport, endosome to Golgi; positive regulation of BMP signaling pathway
Research Articles on UBE2O
Similar Products
Product Notes
The UBE2O ube2o (Catalog #AAA3213436) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2O antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2O can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBE2O ube2o for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YNEAGFDSDR GLQEGYENSR CYNEMALIRV VQSMTQLVRR PPEVFEQEIR. It is sometimes possible for the material contained within the vial of "UBE2O, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
